DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Agpat5

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_081068.1 Gene:Agpat5 / 52123 MGIID:1196345 Length:365 Species:Mus musculus


Alignment Length:220 Identity:50/220 - (22%)
Similarity:69/220 - (31%) Gaps:97/220 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RYLSWRLRTVWLLGWVVRYGL----------LLPFR-------TIGCW---LCLFMI---SGVSM 168
            |||   |.:|.|||....|.|          |:|.|       .:.|.   :.||..   :||.:
Mouse    13 RYL---LPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQNMVLFFFENYTGVQI 74

  Fly   169 LL-GHIPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVL-MC 231
            || |.:|    |.|                       .|..|       :.||.|.:|.:|. |.
Mouse    75 LLYGDLP----KNK-----------------------ENVIY-------LANHQSTVDWIVADML 105

  Fly   232 DANYSLTGQV--------------------HTGILGVLQRALSRVSHHMWFDRKELADREALGLV 276
            .|.....|.|                    |.||.         |.....|:.||:..:      
Mouse   106 AARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIY---------VKRSAKFNDKEMRSK------ 155

  Fly   277 LRLHCSMKDRPPVLLFPEGTCINNT 301
            |:.:.:......:::|||||..|.|
Mouse   156 LQSYVNAGTPMYLVIFPEGTRYNAT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 26/132 (20%)
Agpat5NP_081068.1 LPLAT_LCLAT1-like 63..264 CDD:153252 36/167 (22%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 93..98 2/4 (50%)
Acyltransf_C 260..319 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.