DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Agpat1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006256034.1 Gene:Agpat1 / 406165 RGDID:1303287 Length:322 Species:Rattus norvegicus


Alignment Length:323 Identity:68/323 - (21%)
Similarity:113/323 - (34%) Gaps:110/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KNRLNIRVEQCCDFITAGLGLVLEDDVTQRFVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTVWLL 139
            |..||.||::                ||:..:.|    |.|..|.       ..|...|.|:|..
  Rat    26 KGELNARVQK----------------VTRMELWP----GAWTALL-------LLLLLLLSTLWFC 63

  Fly   140 GWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAACLPMIRRF 204
            ....:|...:.|  ...|:....|..       ||....:.:.||.:     :|....|..::..
  Rat    64 SSSAKYFFKMAF--YNGWILFLAILA-------IPVCAVRGRNVENM-----KILRLLLLHVKYL 114

  Fly   205 HN--------TEYRPTKG-ICVCNHTSPLDVLVLM------C------DANYSLTGQVHTGILGV 248
            :.        ..:.||:. :.|.||.|.||:|.:|      |      :..::.:..:...:.||
  Rat   115 YGIRVEVRGAQHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVPIAKRELLWAGSAGLACWLAGV 179

  Fly   249 LQRALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRP-PVLLFPEGTCINNTAVMQFKKGSF- 311
            :           :.|||...|  |:.::..:..::..:. .|.:|||||..:|.:::.||:|:| 
  Rat   180 I-----------FIDRKRTGD--AISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFH 231

  Fly   312 -AVSDVVHPVAI----------RYDRRFGE----------------------AYWDSTRYSML 341
             ||...|..|.|          :.:|||..                      |..|..|:|||
  Rat   232 LAVQAQVPIVPIVMSSYQDFYCKKERRFTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSML 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 45/207 (22%)
Agpat1XP_006256034.1 LPLAT_AGPAT-like 104..290 CDD:153251 40/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.