DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and aup1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_005173140.1 Gene:aup1 / 324654 ZFINID:ZDB-GENE-030131-3375 Length:429 Species:Danio rerio


Alignment Length:260 Identity:69/260 - (26%)
Similarity:110/260 - (42%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LLLPFRTIG-CWLCLFMISGVSMLLGH--IPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTE 208
            |||.:..:| |.:.|.:..||.:.|..  :||        .:|.|...||..:.|.:    |..:
Zfish    24 LLLLYAPVGFCLMLLRIFIGVHVFLVSCALPD--------SIVRRFIVRIMCSVLGL----HVQQ 76

  Fly   209 YRP-----TKGICVCNHTSPLD--VLVLMCDANYSLTGQVHTGILGVL--QRALSRVSHHMWFDR 264
            ..|     |..:.||||.:..|  ::.|:...|..|.    .|.:|.|  .|....:...:. .|
Zfish    77 NSPRLRDKTTRLYVCNHVTHFDHNIINLLTSCNTPLL----EGPVGFLCWARGFMELGQGVG-SR 136

  Fly   265 KELADREALGLVLRLHCSMKDRPPVLLFPEGTCIN-NTAVMQFKKGSFAVSDVVHPVAIRYDRRF 328
            .||.:      .|..:||..|..|:|||||....| .|.:::|....|:|||.:.|||:...|.|
Zfish   137 TELTE------TLHRYCSSPDTLPLLLFPEEDTTNGRTGLLKFSSWPFSVSDSIQPVALLVKRPF 195

  Fly   329 -----GEAYWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDESPVEFSNRVKAAIAAQANI 388
                 .|:.|       |..:|...........|.::|.||:.:.|:..||:::|:..:|.:..:
Zfish   196 IAVSTPESSW-------LTELLWTFFVPFTVYHVRWLPPLSKEDGETHQEFASKVQGLLATELGV 253

  Fly   389  388
            Zfish   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 56/213 (26%)
aup1XP_005173140.1 LPLAT 63..263 CDD:302626 56/213 (26%)
CUE_AUP1 310..354 CDD:270603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.