DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Agpat2

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001101291.1 Gene:Agpat2 / 311821 RGDID:1309229 Length:278 Species:Rattus norvegicus


Alignment Length:201 Identity:46/201 - (22%)
Similarity:77/201 - (38%) Gaps:72/201 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLGWVVR-----YGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAAC 197
            ::.|.||     |||            .|.:||             :|||         .:...|
  Rat    62 IISWFVRSFKYVYGL------------RFEVSG-------------QKKL---------EVDGPC 92

  Fly   198 LPMIRRFHNTEYRPTKGICVCNHTSPLDVLVLM------CDANYSLTGQVHTGILGVLQRALSRV 256
                             :.:.||.|.||::.||      | ...:....:.||.:|::. .|..|
  Rat    93 -----------------VIISNHQSILDMMGLMEILPKRC-VQIAKRELMFTGPVGLIM-YLGGV 138

  Fly   257 SHHMWFDRKELADREALGLVLRL-HCSMKDRPPVLLFPEGTCINNTAVMQFKKGSF--AVSDVVH 318
                :|..::.| :.|:.|:..| ...:|:...|.::||||..:|..::.||||:|  |:...|.
  Rat   139 ----YFINRQQA-KTAMSLMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVP 198

  Fly   319 PVAIRY 324
            .:.:.|
  Rat   199 IIPVVY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 34/143 (24%)
Agpat2NP_001101291.1 LPLAT_AGPAT-like 67..240 CDD:153251 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.