DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Lpcat2

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_766602.1 Gene:Lpcat2 / 270084 MGIID:3606214 Length:544 Species:Mus musculus


Alignment Length:360 Identity:86/360 - (23%)
Similarity:137/360 - (38%) Gaps:95/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FVAPPSPAGEWNLLTRNLRQRNRYLSWRLRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGVSML 169
            |..||.|       ...::|.....|.||: ::|||.:     |||.|.        ::.|:.:|
Mouse    35 FFPPPVP-------NPFVQQTTISASRRLQ-MFLLGII-----LLPVRA--------LLVGIILL 78

  Fly   170 LGHIPDW--------CFKKKLVELVLRQCFRITAACLPMIRR--FHNTEYRPT-KG--------- 214
            |.    |        |..:||...:.....:||...|..:.|  |.:..:..| ||         
Mouse    79 LA----WPFAVISTACCPEKLTHPISNWRRKITRPALTFLARAMFFSMGFTVTVKGKVASPLEAP 139

  Fly   215 -ICVCNHTSPLDVLVLMCDANYSLTGQ---VHTGILGVLQRAL-----SRVSHHMWFDRK----E 266
             ..|..|::..|.:..:.....||..:   ..|.::|.|.|||     |||...   .||    |
Mouse   140 IFVVAPHSTFFDGIACVVAGLPSLVSRNENAQTPLVGRLLRALQPVLVSRVDPD---SRKNTINE 201

  Fly   267 LADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQFKKGSFAVSDVVHPVAIRYDRRFGEA 331
            :..|...|         .:.|.:|:||||||.|.:.::.||.|:|.....|.||.:||..:....
Mouse   202 IKKRATSG---------GEWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRYPNKLDTV 257

  Fly   332 YWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDE--SPVEFSNRVKAAIAAQANI------ 388
            .|....|:.|:..::.........::.:||..:...:|  .||.|::|::..:|....|      
Mouse   258 TWTWQGYTFLQLCVLTFCQLFTKVEIEFMPVQAPSEEEKNDPVLFASRIRNLMAEALEIPVTDHT 322

  Fly   389 -DD-----------LPWDGNLKRWSPVR-----DW 406
             :|           ||.:..|..:|.:.     ||
Mouse   323 YEDCRLMISAGQLTLPMEAGLVEFSKISRKLKLDW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 61/252 (24%)
Lpcat2NP_766602.1 PlsC 69..>254 CDD:223282 53/208 (25%)
LPLAT_LPCAT1-like 115..327 CDD:153253 55/223 (25%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 146..151 1/4 (25%)
EGTC motif 220..223 2/2 (100%)
EFh 396..458 CDD:238008
EF-hand_7 396..457 CDD:290234
EF-hand_7 433..489 CDD:290234
EFh 433..486 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..544
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.