DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and vps66

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_593657.2 Gene:vps66 / 2542362 PomBaseID:SPAC1783.02c Length:300 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:56/216 - (25%)
Similarity:83/216 - (38%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LLPFRTIGC---------WLCL--FMISGVSMLLGHIPDW----CFKKKLVELVLRQCF------ 191
            :.||..|..         |:.:  .||..|.:.:..:..|    ||.|.::.:..:..|      
pombe    14 IAPFHPINTETPSGFNFKWILIVVVMILRVPLCIISVTLWFLWSCFLKPILSIQPKLSFFIDSSL 78

  Fly   192 -RITAACLPMIRRFHNTEYRPTKG-------ICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGV 248
             |:...|...::...:|.....:|       |...||:||||||||.|  .|:.|       ..|
pombe    79 SRLLLLCFGCLKLSKSTSGSFVQGDSLQPGDILAVNHSSPLDVLVLSC--LYNCT-------FAV 134

  Fly   249 LQRALSRVS-----HHMW---FDRKELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQ 305
            .....|.||     .:.|   |...:|...:|..|......:.|....|:|||||.|.|..|:.|
pombe   135 CDSKTSNVSIISAQAYFWSCFFSPSKLKITDAKPLAKVAAKASKIGTVVILFPEGVCTNGRALCQ 199

  Fly   306 FKK--GSFAVSDVVHPVAIRY 324
            |..  .|...:|.:.|:.|:|
pombe   200 FTPCFDSAKETDRIFPLYIKY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 45/158 (28%)
vps66NP_593657.2 LPLAT 86..275 CDD:153244 42/144 (29%)
PlsC <110..300 CDD:223282 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I3726
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.