DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and LCLAT1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_872357.2 Gene:LCLAT1 / 253558 HGNCID:26756 Length:414 Species:Homo sapiens


Alignment Length:231 Identity:48/231 - (20%)
Similarity:84/231 - (36%) Gaps:77/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LSWR-LRTVWLLGWVVRYG---LLLPF----------------RTIGCWLCLFMISGVSMLLGHI 173
            :||: :..:..|.|...:|   :|.||                |.:..||.|    .|::|    
Human    40 VSWKGIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTL----PVALL---- 96

  Fly   174 PDWCFKKKLVELVLRQCFRITA-ACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVLM-CDANYS 236
             :..|..|::         ||. |.:|           ..:.:.:.||.:.:|.:.|. |...||
Human    97 -ETMFGVKVI---------ITGDAFVP-----------GERSVIIMNHRTRMDWMFLWNCLMRYS 140

  Fly   237 --------LTGQVHTGILG---VLQRALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRPPVL 290
                    |...: .|:.|   .:|.|.....|..|.|     |:.....::...|.:.:...:|
Human   141 YLRLEKICLKASL-KGVPGFGWAMQAAAYIFIHRKWKD-----DKSHFEDMIDYFCDIHEPLQLL 199

  Fly   291 LFPEGTCINNTAVMQFKKGSFAVSD-------VVHP 319
            :|||||.:...:  :.:..:||..:       |:||
Human   200 IFPEGTDLTENS--KSRSNAFAEKNGLQKYEYVLHP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 32/149 (21%)
LCLAT1NP_872357.2 PRK14014 45..324 CDD:237584 46/226 (20%)
LPLAT_LCLAT1-like 93..286 CDD:153252 36/174 (21%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 123..128 1/4 (25%)
Acyltransf_C 272..344 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.