DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Lpgat1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001128301.1 Gene:Lpgat1 / 226856 MGIID:2446186 Length:409 Species:Mus musculus


Alignment Length:203 Identity:41/203 - (20%)
Similarity:72/203 - (35%) Gaps:71/203 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 WLLGWVV-----RYGLLLPFRTIG-----CWLCL------------FMISGV--SMLLGHIPDWC 177
            | |||:|     |:..::....:.     |::.:            :.|.|:  ..|||.:..|.
Mouse    49 W-LGWIVAKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGLMYKWLLGMVASWG 112

  Fly   178 FKKKLVELVLRQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVL-MC---------- 231
            :......:...:..:..|               ..:.:.:.||.:..||..| ||          
Mouse   113 WYAGYTVMEWGEDIKAIA---------------KDEAVMLVNHQATGDVCTLMMCLQDKGPVVAQ 162

  Fly   232 -----DANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLRLHCS----MKDRP 287
                 |..:..|   :.||:.::        |..:|.|:..|.|:...|||:.|..    .:||.
Mouse   163 MMWLMDHIFKYT---NFGIVSLI--------HGDFFIRQGRAYRDQQLLVLKKHLEHNYRSRDRK 216

  Fly   288 PVLLFPEG 295
            .::|||||
Mouse   217 WIVLFPEG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 28/125 (22%)
Lpgat1NP_001128301.1 LPLAT_LCLAT1-like 108..324 CDD:153252 29/143 (20%)
Acyltransf_C 313..382 CDD:374349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.