DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and bus-18

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_505971.2 Gene:bus-18 / 186277 WormBaseID:WBGene00044631 Length:391 Species:Caenorhabditis elegans


Alignment Length:280 Identity:55/280 - (19%)
Similarity:101/280 - (36%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLGWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFRITAACLPMIR 202
            ||||.  :||.:.|..:.....:.:..|:. :||....|   :.|::..:.....|....|..:.
 Worm    10 LLGWF--FGLCILFSALFGNYIITLFLGLP-ILGRHKQW---RNLMDRAISYWMTIPMGLLEFLM 68

  Fly   203 ----RFHNTEYR-PTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRV------ 256
                |....|.. .:..:.|.||.:.||.:.:.| |.|.:...:.|.....|:..|.::      
 Worm    69 GVRIRVSGDEIEFGSPAMIVMNHRTRLDWMYMWC-ALYQINPWLITSNKISLKAQLKKLPGAGFG 132

  Fly   257 ---SHHMWFDRKELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQFKKGSFAVSD-VV 317
               :..::.:|....|:.:....:....::..:..:|||||||  :.:.....|...||..: :.
 Worm   133 MAAAQFVFLERNAEVDKRSFDDAIDYFKNIDKKYQILLFPEGT--DKSEWTTLKSREFAKKNGLR 195

  Fly   318 HPVAIRYDRRFGEAYWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDESPVEFSNRVKAAI 382
            |...:.|.|..|                             ::..|::..::..||:...:  .|
 Worm   196 HLDYVLYPRTTG-----------------------------FLHLLNKMREQEYVEYIYDI--TI 229

  Fly   383 AAQANIDDLPWDGNLKRWSP 402
            |...||.....|..||..||
 Worm   230 AYPYNIVQSEIDLVLKGASP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 40/222 (18%)
bus-18NP_505971.2 LPLAT_LCLAT1-like 63..257 CDD:153252 42/221 (19%)
Acyltransf_C 249..329 CDD:374349 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.