DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and acl-12

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_509260.1 Gene:acl-12 / 181001 WormBaseID:WBGene00015295 Length:391 Species:Caenorhabditis elegans


Alignment Length:145 Identity:31/145 - (21%)
Similarity:53/145 - (36%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 YRPTKGICVCNHTSPLDVLVLMCDAN-------------YSLTGQVHTGILGVLQRALSRVSHHM 260
            |...|.:.:.||...||..|||...|             |::......|::.        .||..
 Worm   113 YAEEKCLLLANHLGLLDHFVLMQSLNGKGSIRSRWMWVIYNIWKYTPLGVMW--------TSHGN 169

  Fly   261 WFDRKELADREALGLVLRLHCSMK----DRPPVLLFPEGTCI----NNTAVMQFKKGSFAVSDVV 317
            :|....::.|:::....|.|....    |...|:::|||:.:    |:......|.|...:.:.|
 Worm   170 FFVNGGVSKRDSVLSSFRDHLKNSFYKYDYGWVIMYPEGSRLYLVKNSGRTFAEKNGLKPLDNCV 234

  Fly   318 HPVAIRYDRRFGEAY 332
            :|       |.|.|:
 Worm   235 YP-------RTGAAH 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 31/145 (21%)
acl-12NP_509260.1 LPLAT <156..290 CDD:302626 20/102 (20%)
Acyltransf_C 302..364 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.