DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and acl-8

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001348648.1 Gene:acl-8 / 179031 WormBaseID:WBGene00020264 Length:372 Species:Caenorhabditis elegans


Alignment Length:234 Identity:49/234 - (20%)
Similarity:80/234 - (34%) Gaps:68/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 YLSWRLRTVWLLGWVVRYGLLLP--FRT-----IGCWLCLFMISGVSMLLGHIPDWCFKKKLVEL 185
            :.|..|.||:||..::......|  :||     :|.||                  .|...|:|.
 Worm    14 FFSSLLGTVFLLFPLIPLAWFAPKLWRTCADRLVGFWL------------------TFPCSLIEW 60

  Fly   186 VLRQCFRITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQ 250
            |....||:|...:.          |....|.:.||.:.||.| ...:|.|.:...:.|.....|:
 Worm    61 VFGVNFRVTGDLIE----------RDEPAILIMNHRTRLDWL-FSWNALYKMDPWLLTTEKISLK 114

  Fly   251 RALSRV---------SHHMWFDRKELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQF 306
            ..|.::         ..:::.||....|:..|..:::.:...:.:..:|||.|||          
 Worm   115 APLKKIPGAGWAMSSGSYIFLDRNFENDKPVLERIVKYYSGSEKKYQILLFAEGT---------- 169

  Fly   307 KKGSFAVSDVVHPVAIRYDRRFGEAYWDSTRYSMLRYML 345
            .||..|.             |..:|:.|........|:|
 Worm   170 DKGERAT-------------RLSDAFADKNGLPRYEYVL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 33/164 (20%)
acl-8NP_001348648.1 LPLAT_LCLAT1-like 55..250 CDD:153252 36/175 (21%)
Acyltransf_C 236..313 CDD:374349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.