DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and Agpat4

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006227918.1 Gene:Agpat4 / 170919 RGDID:619916 Length:414 Species:Rattus norvegicus


Alignment Length:306 Identity:73/306 - (23%)
Similarity:125/306 - (40%) Gaps:82/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FVAPPSPAGEWNLLTRNLRQRNRYLSW-RLRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGV-- 166
            |::|    |.::||.   ..|:.|||. ..|.:.|:|.:....|.   ..:.|:  :|:.||:  
  Rat    12 FLSP----GSFSLLE---LFRHTYLSLENPRIMDLIGLLKSQFLC---HLVFCY--VFIASGLIV 64

  Fly   167 -SMLLGHIPDWCFKKKLVELV-LRQCFRITAACLPMIRRFHNTE------------YRPTKGICV 217
             ::.|..:..|...|:|...: .|.|:.:::..:.::..:..||            |.....|.|
  Rat    65 NAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKASPHYGKENAIVV 129

  Fly   218 CNHTSPLDVLVLMCDANYSLTGQVHTGILG---VLQR---ALSRVSHHMWF-------DRKELAD 269
            .||...:|.|     ..:||..::  ||||   ||.:   |...:...||:       .||...|
  Rat   130 LNHKFEIDFL-----CGWSLAERL--GILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQD 187

  Fly   270 REALGLVLRLHCSMKDRPPVLLF---PEGTCINNTAVMQFKKGSFAVSDVVHPVAIRYDRRFGEA 331
            |:.:...| ||  ::|.|...||   .|||....      ||         |.::::..:..|  
  Rat   188 RQTVAKSL-LH--LRDYPEKYLFLIHCEGTRFTE------KK---------HQISMQVAQAKG-- 232

  Fly   332 YWDSTRYSML-RYMLMVVSSWCICCDVWYMPALSRC-----NDESP 371
             ..|.::.:| |.....::..|: .||  :||:..|     |:|:|
  Rat   233 -LPSLKHHLLPRTKGFAITVKCL-RDV--VPAVYDCTLNFRNNENP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 50/215 (23%)
Agpat4XP_006227918.1 PlsC 51..325 CDD:223282 60/257 (23%)
LPLAT_LCLAT1-like 98..292 CDD:153252 50/208 (24%)
Acyltransf_C 279..350 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.