DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and LOC1271324

DIOPT Version :10

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_061515083.1 Gene:LOC1271324 / 1271324 VectorBaseID:AGAMI1_010019 Length:148 Species:Anopheles gambiae


Alignment Length:38 Identity:15/38 - (39%)
Similarity:20/38 - (52%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 VLLFPEGTCINNTAVMQFKKGSFAVS----DVVHPVAI 322
            :|.|||||......::.||||.|.|:    ..:.||.|
Mosquito    23 LLFFPEGTRGTGDKLLPFKKGCFHVAVESQAFIQPVVI 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 15/38 (39%)
LOC1271324XP_061515083.1 None

Return to query results.
Submit another query.