Sequence 1: | NP_608409.1 | Gene: | CG15450 / 33064 | FlyBaseID: | FBgn0031132 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006403.2 | Gene: | AGPAT2 / 10555 | HGNCID: | 325 | Length: | 278 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 76/205 - (37%) | Gaps: | 70/205 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 CWLCLFMISGVS---MLLGH---------IPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTE 208
Fly 209 YRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREAL 273
Fly 274 GLVLRL----------------------HCSMKDRPPVLLFPEGTCINNTAVMQFKKGSF--AVS 314
Fly 315 DVVHPVAIRY 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15450 | NP_608409.1 | LPLAT_LPCAT1-like | 191..399 | CDD:153253 | 36/158 (23%) |
AGPAT2 | NP_006403.2 | LPLAT_AGPAT-like | 67..249 | CDD:153251 | 38/171 (22%) |
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 | 98..103 | 2/4 (50%) | |||
EGTR motif. /evidence=ECO:0000305|PubMed:21873652 | 172..175 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |