DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and AGPAT2

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_006403.2 Gene:AGPAT2 / 10555 HGNCID:325 Length:278 Species:Homo sapiens


Alignment Length:205 Identity:49/205 - (23%)
Similarity:76/205 - (37%) Gaps:70/205 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 CWLCLFMISGVS---MLLGH---------IPDWCFKKKLVELVLRQCFRITAACLPMIRRFHNTE 208
            |.|| |.:|.|:   .||.|         |..|..:.......||  |.:...     ||..  |
Human    34 CALC-FTVSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYGLR--FEVRDP-----RRLQ--E 88

  Fly   209 YRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREAL 273
            .||.  :.|.||.|.||::                |::.||.....:::      ::||.....:
Human    89 ARPC--VIVSNHQSILDMM----------------GLMEVLPERCVQIA------KRELLFLGPV 129

  Fly   274 GLVLRL----------------------HCSMKDRPPVLLFPEGTCINNTAVMQFKKGSF--AVS 314
            ||::.|                      ...:::...|.::||||..:|..::.||||:|  ||.
Human   130 GLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQ 194

  Fly   315 DVVHPVAIRY 324
            ..|..|.:.|
Human   195 AQVPIVPVVY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 36/158 (23%)
AGPAT2NP_006403.2 LPLAT_AGPAT-like 67..249 CDD:153251 38/171 (22%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 98..103 2/4 (50%)
EGTR motif. /evidence=ECO:0000305|PubMed:21873652 172..175 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.