DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and AGPAT1

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001358366.1 Gene:AGPAT1 / 10554 HGNCID:324 Length:287 Species:Homo sapiens


Alignment Length:291 Identity:63/291 - (21%)
Similarity:108/291 - (37%) Gaps:99/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GEWNLLTRNLRQRNRYLSWRLRTVWLLGWVVRYGLLLPFRTIGCWLCLFMISGVSMLLGHIPDWC 177
            |.|.||....    ..|.:.|.|:|......:|...:.|  ...|:....:..:.:        |
Human    10 GAWMLLLLLF----LLLLFLLPTLWFCSPSAKYFFKMAF--YNGWILFLAVLAIPV--------C 60

  Fly   178 FKK-------KLVELVL---RQCFRITAACLPMIRRFHNTEYRPTKG-ICVCNHTSPLDVLVLMC 231
            ..:       |::.|:|   :..:.|...    :|..|:  :.|::. :.|.||.|.||:|.:| 
Human    61 AVRGRNVENMKILRLMLLHIKYLYGIRVE----VRGAHH--FPPSQPYVVVSNHQSSLDLLGMM- 118

  Fly   232 DANYSLTGQVHTG-ILGVLQRALSRVSHHMW---------------FDRKELADREALGLVLRLH 280
                    :|..| .:.:.:|.|      :|               .|||...|  |:.::..:.
Human   119 --------EVLPGRCVPIAKREL------LWAGSAGLACWLAGVIFIDRKRTGD--AISVMSEVA 167

  Fly   281 CSMKDRP-PVLLFPEGTCINNTAVMQFKKGSF--AVSDVVHPVAI----------RYDRRF--GE 330
            .::..:. .|.:|||||..:|.:::.||:|:|  ||...|..|.|          :.:|||  |:
Human   168 QTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQ 232

  Fly   331 --------------------AYWDSTRYSML 341
                                |..|..|:|||
Human   233 CQVRVLPPVPTEGLTPDDVPALADRVRHSML 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 48/203 (24%)
AGPAT1NP_001358366.1 LPLAT_AGPAT-like 73..259 CDD:153251 46/208 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.