DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15450 and LOC101884921

DIOPT Version :9

Sequence 1:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_021322740.1 Gene:LOC101884921 / 101884921 -ID:- Length:529 Species:Danio rerio


Alignment Length:123 Identity:35/123 - (28%)
Similarity:54/123 - (43%) Gaps:16/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 PPVLLFPEGTCINNTAVMQFKKGSFAVSDVVHPVAIRYDRRFGEAYWDSTRYSMLRYMLMVVSSW 351
            |.:::||||||.|.:.::.||.|:|..:..|.||.|||..:.....|...........:.|....
Zfish   189 PQIMIFPEGTCTNRSCLITFKPGAFIPAVPVQPVVIRYPNQLDSITWTWQGPGANERPVCVCVCV 253

  Fly   352 CIC-CDVWYMPALSRCNDE--SPVEFSNRVKAAIAAQANIDDLPWDGNLKRWSPVRDW 406
            |:| |...|:|..|...:|  :|..|:|.|:..:|....:             ||.|:
Zfish   254 CVCVCVSQYLPTYSPSEEEKKNPALFANNVRRLMAKALQV-------------PVTDY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 32/114 (28%)
LOC101884921XP_021322740.1 LPLAT_LPCAT1-like 91..303 CDD:153253 35/123 (28%)
EFh_CREC <329..>394 CDD:330175
EF-hand motif 342..369 CDD:320021
EFh_PEF <368..474 CDD:330173
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.