DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shakB and Inx3

DIOPT Version :9

Sequence 1:NP_608410.2 Gene:shakB / 33062 FlyBaseID:FBgn0085387 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster


Alignment Length:364 Identity:145/364 - (39%)
Similarity:226/364 - (62%) Gaps:7/364 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VYAFMQVSRSSVSHVKIDSPVFRLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIPEDVLNT 226
            |..|::: |..:....||:.|||.|...|..:|.|..|.||....:|:||.|::...||..|:||
  Fly    10 VSGFIKI-RYLLDKAVIDNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIPMHVINT 73

  Fly   227 YCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLW 291
            :|||..|||:.....::.|::|..||:.|..|:..   ::..|||||.|.||||.::||.|.|:|
  Fly    74 FCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQEK---RYHSYYQWVPFVLFFQGLMFYVPHWVW 135

  Fly   292 KSWEGGKIHALIMDLDIGICSEAE--KKQKKKLLLDYLWENLRYHNWWAYRYYVCELLALINVIG 354
            |:.|.|||. :|.|...|:.|..:  ::.::..:|.|...:|..||.:::.|:.||||..||||.
  Fly   136 KNMEDGKIR-MITDGLRGMVSVPDDYRRDRQDRILKYFVNSLNTHNGYSFAYFFCELLNFINVIV 199

  Fly   355 QMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICIL 419
            .:|::::|..|.|:::|..|:.:...||:.|.||||.||||:|||||.|:|.||.|:|||.:|:|
  Fly   200 NIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVL 264

  Fly   420 PLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVRRDAIEIIVRRSK 484
            .||::|||||||||||||:|..::.:.::|.:|:|..|..|..:.:..:|..:|..|..:|||.:
  Fly   265 ALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTRETIIKRSYRSAQRKEIAGLVRRLE 329

  Fly   485 MGDWFLLYLLGENIDTVIFRDVVQDLANRLGHNQHHRVP 523
            :||:.:|:.|.:|:.|..:.|::|.|...||.::....|
  Fly   330 IGDFLILHFLSQNLSTRSYSDMLQQLCGLLGASRTPSAP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shakBNP_608410.2 Innexin 179..514 CDD:279248 138/336 (41%)
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 137/333 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
98.970

Return to query results.
Submit another query.