DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shakB and inx-20

DIOPT Version :9

Sequence 1:NP_608410.2 Gene:shakB / 33062 FlyBaseID:FBgn0085387 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001251235.1 Gene:inx-20 / 188818 WormBaseID:WBGene00002142 Length:483 Species:Caenorhabditis elegans


Alignment Length:437 Identity:98/437 - (22%)
Similarity:182/437 - (41%) Gaps:82/437 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ADTVKQYISRAQRTTKKGSQEQQNMEF--LRGVYAFMQVSRSSVSHVKIDSPVF-RLHTNATVIL 193
            |..:.|:.:.:.:|..........|.|  :.|..:|:|        .:.|..:| |||...|...
 Worm     3 AQALPQHSASSNKTGGSPGARVPRMVFAEIVGTLSFLQ--------PQADDDIFDRLHYYYTTTF 59

  Fly   194 LITFSIAVTTRQYVGNPIDC---VHTRDIPEDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHN 255
            |:..::.::.:.:.|.||:|   ...:...||....|||..:||  |.||     .:...|.|.|
 Worm    60 LLLTAVLISLKMFGGRPIECWLPAEYKSSWEDYTEMYCWARNTY--VTAF-----EDDNLPEVVN 117

  Fly   256 SQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKIHALIMDLDIGICSE------A 314
            .:      .....|||||.|.|.:.|..||.|..:|:.:. .|....:.|: :|..::      .
 Worm   118 RE------YTMVSYYQWVPFFLVYVAFSFYAPCLIWRLFY-DKSGIRLKDI-MGFANDKANVVPT 174

  Fly   315 EKKQKKKLLLDYLWE----------------------NLRYH-NWWAYRYYVCELLALINVIGQM 356
            ::....:.|..:|..                      |:||: ::..|.|...:.|.|:||:.||
 Worm   175 QRTANIRGLSAHLSSVFKHRFRIGEKHPYHHKVFRIFNVRYYESYLTYLYLAIKCLFLMNVLTQM 239

  Fly   357 FLMNRFFD---GEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICI 418
            :.|:||.:   ..:..:|:.....|....::..:     ||.:|.|. .:....|.|::|...|:
 Worm   240 YFMSRFLELDSHRYYGYGIFYDLIMGKGWKESSN-----FPVVTYCD-MQIRILGHVQRHTVQCV 298

  Fly   419 LPLNVVNEKIYIFLWFWFI---LLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLV-------RR 473
            |.:|:..|||:..||.|:.   |::|.::|:.|: ..|.|:.|.:....|:....|       ::
 Worm   299 LVINIFTEKIFFILWLWYTMLSLISFGSILSWIF-ASIPFNQRRQFIARRLELADVNFEKSRFKQ 362

  Fly   474 DAIEIIVRRSKMGDWFLLYLLGENIDTVIFRDVVQDLANRL----GH 516
            :..|.:....|:...|:|.::..:...::..|:|..:.::.    ||
 Worm   363 ELDEFVRDYIKIDGIFVLRMITIHSGILMCTDIVDTMWDQFLQESGH 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shakBNP_608410.2 Innexin 179..514 CDD:279248 88/380 (23%)
inx-20NP_001251235.1 Innexin 45..403 CDD:279248 87/379 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.