DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shakB and inx-5

DIOPT Version :9

Sequence 1:NP_608410.2 Gene:shakB / 33062 FlyBaseID:FBgn0085387 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_509403.2 Gene:inx-5 / 181086 WormBaseID:WBGene00002127 Length:447 Species:Caenorhabditis elegans


Alignment Length:371 Identity:93/371 - (25%)
Similarity:149/371 - (40%) Gaps:97/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LITFS-IAVTTRQYVGNPIDCVHTRDIP-------EDVLNTYCWIHSTYTVVDAFMKKQGSEVPF 250
            |:.|| |.:...||||.||.|.    :|       |....|||:|..||.:              
 Worm    33 LLGFSAIMMAASQYVGRPIQCW----VPAQFTRTWEKYAETYCFIKGTYFL-------------- 79

  Fly   251 PGVHNSQGRGPLT--------IKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGG---KIHALIM 304
            ||...|:|...:|        .....||||:...|..||.|||.|..:|:::...   ||.    
 Worm    80 PGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIK---- 140

  Fly   305 DLDIGICSEAEKKQKKKLLLD---------YLWENLRYHN----------------WWAYRYYVC 344
              ::...|||.:|.|..:..|         |.::.|.:.|                :....|.:.
 Worm   141 --ELAAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNFRNESPVFKETGSVVASGKFLPALYLLV 203

  Fly   345 ELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGE 409
            ::|.|.|::.|.:::..|.:.:...:|.:....:...:|.....   ||||:|.|. |.......
 Worm   204 KILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTG---IFPRVTMCD-FSIMDLTS 264

  Fly   410 VEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVI----------IFS-----PRM 459
            |..|...|::.:|::.||:|:|.|||.:.:..||:.:|.|..||          |:|     |..
 Worm   265 VHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEF 329

  Fly   460 RVYLFRMRF-------RLVRRDAIEI--IVRRSKMGDWFLLYLLGE 496
            :....|..|       :.:..|.:.|  :|:::. ||.|...:|||
 Worm   330 QTEQERGSFVPANFVDKCLTPDGVFISRLVQQNS-GDLFTSIMLGE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shakBNP_608410.2 Innexin 179..514 CDD:279248 93/371 (25%)
inx-5NP_509403.2 Innexin 20..379 CDD:279248 93/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.