DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shakB and inx-5

DIOPT Version :10

Sequence 1:NP_608410.2 Gene:shakB / 33062 FlyBaseID:FBgn0085387 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_509403.2 Gene:inx-5 / 181086 WormBaseID:WBGene00002127 Length:447 Species:Caenorhabditis elegans


Alignment Length:67 Identity:20/67 - (29%)
Similarity:28/67 - (41%) Gaps:18/67 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLN--GEIGEWDSEFLKLDQNTLFDLV-------------LAANYLN-IENLFDVTTQFIANMMK 78
            |||  .|:..|..|...|.|. |..|.             |:.|.|| :||..:::.:.| .|.|
 Worm    79 LLNPASEVKFWQREAAVLRQE-LHALQENHRQMMGEQLNGLSVNELNSLENQIEISLRGI-RMRK 141

  Fly    79 NN 80
            |:
 Worm   142 ND 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shakBNP_608410.2 Innexin 180..513 CDD:459975
inx-5NP_509403.2 Innexin 20..376 CDD:459975 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.