DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shakB and inx-14

DIOPT Version :9

Sequence 1:NP_608410.2 Gene:shakB / 33062 FlyBaseID:FBgn0085387 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_492078.1 Gene:inx-14 / 172488 WormBaseID:WBGene00002136 Length:434 Species:Caenorhabditis elegans


Alignment Length:395 Identity:95/395 - (24%)
Similarity:166/395 - (42%) Gaps:90/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIPE---------DVLNTYCWIHSTYTV-VD 238
            |||. .||.||..|.:....:|:.||||||:    :|:         |.::.:|..:.|:.. |.
 Worm    27 RLHL-FTVYLLGFFVLLTGAKQHFGNPIDCM----LPKQHDDLKSWRDYIHNFCLFYGTFRYDVS 86

  Fly   239 AFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWKSWEGGKI---- 299
            ....:.||......|:              |||||.|...||...|..|.|.|...:  |:    
 Worm    87 NGTSEFGSYTEDASVN--------------YYQWVPFFFAFQVCCFLLPFWCWAYMQ--KLIYID 135

  Fly   300 HALIMDLDIGICSEA--EK-KQKKKLLLDYLWENLR--------YHNWWAYR-------YYVCEL 346
            .|.|:|....|.||.  || |:|...:::|:.::.:        |.:|..:.       |.:.:|
 Worm   136 MAFIVDYSGKINSEKTFEKTKEKVDRIVNYMHDHFKFRRAHKMGYLSWITFNSAFPSVLYSLTKL 200

  Fly   347 LALINVIGQMFLMNRFFDGEFITFGLKVI-----------DYMETDQEDRMDPMI--------YI 392
            ..:.|||.|:.|:.:|.|.:..|:|..::           ::.....:.|...::        ..
 Worm   201 FFITNVIIQVNLVCKFLDVDSWTWGFDLLGKFIHPTPRAPEFSSFSDKQRFAAILTDGSYNRFQY 265

  Fly   393 FPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSP 457
            ||.:..|.:....|......|.|.||:|:||:||||:|.|:||.::||.|:::..:..::.|.|.
 Worm   266 FPILVGCEYQLQESVSNFVNHKAQCIIPMNVINEKIFIGLYFWLLVLTALSVIGTVKWILRIKSK 330

  Fly   458 RM-RVYLFRMRFRLVRRDAIEI--------IVRRSKMGDWFLL---------YLLGENIDTVIFR 504
            :: .|.::::..:.:.|:..:.        .|.:....|..||         :|..|.:...:|:
 Worm   331 KLNEVMIYKLIKKSLEREPFDSNIHDHRYNFVHKYLCADGILLIYFMMDTNGFLKTEEVIGALFK 395

  Fly   505 DVVQD 509
            ....|
 Worm   396 KYCSD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shakBNP_608410.2 Innexin 179..514 CDD:279248 95/395 (24%)
inx-14NP_492078.1 Innexin 24..397 CDD:279248 94/390 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.