DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment run and RUNX2

DIOPT Version :9

Sequence 1:NP_001285501.1 Gene:run / 33059 FlyBaseID:FBgn0003300 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001019801.3 Gene:RUNX2 / 860 HGNCID:10472 Length:521 Species:Homo sapiens


Alignment Length:560 Identity:173/560 - (30%)
Similarity:233/560 - (41%) Gaps:173/560 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QVLAAAAAAAAAAAAAVAQGPGPQ-QSSNATTASAIAINPAQSLANTSTHSASSTGSSTPDLSTN 78
            |..|||||||||||||.|..|..: ...|.|....||.:||                        
Human    71 QEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPA------------------------ 111

  Fly    79 NTSSSSNATTSPQNSAKMPSSMTDMFASLHEMLQEYHGELAQTGSPSILCSALPNHWRSNKSLPG 143
                                                  ||.:|.||:.|||.||:|||.||:||.
Human   112 --------------------------------------ELVRTDSPNFLCSVLPSHWRCNKTLPV 138

  Fly   144 AFKVIALDDVPDGTLVSIKCGNDENYCGELRNCTTTMKNQVAKFNDLRFVGRSGRGKSFTLTITI 208
            ||||:||.:|||||:|::..||||||..||||.:..||||||:|||||||||||||||||||||:
Human   139 AFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITV 203

  Fly   209 ATYPVQIASYSKAIKVTVDGPREPR--------SKQSY---------GYPH-------------- 242
            .|.|.|:|:|.:|||||||||||||        ||.|.         ..||              
Human   204 FTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRP 268

  Fly   243 -----PGAFNP-----------FMLNPAW-LDAAYMTYGYADYFRHQAAAQAAQVHHPALAKSSA 290
                 |..|||           ...:|.| .|.:|.:|                     |::.::
Human   269 SLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSY---------------------LSQMTS 312

  Fly   291 SSV-SPNPNPSVATSSSSAVQ--PSEYPHPAAAVAAAAGQPAAM-MPSPPGAAPATPYAIP-QFP 350
            .|: |..|..|...:...|:.  |........|.:.....|:.: ..|..||:...|::.| |||
Human   313 PSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFP 377

  Fly   351 FNHVAAAAAAKAATPHAFHPYNFA----AAAGLR-ARNAALHHQSEPVHVSPASSRPSSSSPTQQ 410
              .:::...::.:.|...:|..|.    ..:|:. ..:|..|:.:......|.||: |.|.|.| 
Human   378 --SISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQ-SQSGPFQ- 438

  Fly   411 HVLLKLNTSIETSSIHEQSASDGDSDDEQIDVVKSEFDLDKSLDVAPLRM--RCDL--KAPSAMK 471
                   || .|..::..::|.           ..:|.:....|.:|.||  .|..  ...:.:.
Human   439 -------TS-STPYLYYGTSSG-----------SYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLN 484

  Fly   472 PLYHESGPGAVAN-SRQPSPETTTKIKSAAVQQKTVWRPY 510
            |.......|..|: |...||   |.:.|:....::|||||
Human   485 PNLPNQNDGVDADGSHSSSP---TVLNSSGRMDESVWRPY 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
runNP_001285501.1 Runt 114..235 CDD:279225 84/128 (66%)
RUNX2NP_001019801.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..59
polyglutamine repeat 49..71 173/560 (31%)
polyalanine repeat 73..89 13/15 (87%)
Runt 109..230 CDD:307137 86/182 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..340 28/138 (20%)
Required for interaction with FOXO1. /evidence=ECO:0000250 242..258 2/15 (13%)
Herpes_BLLF1 <266..481 CDD:330317 49/258 (19%)
Interaction with KAT6A. /evidence=ECO:0000250 336..439 24/113 (21%)
Interaction with KAT6B. /evidence=ECO:0000269|PubMed:11965546 374..468 23/116 (20%)
RunxI 430..521 CDD:312115 26/114 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..521 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3751
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3284
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.