DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:334 Identity:68/334 - (20%)
Similarity:129/334 - (38%) Gaps:103/334 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAIVTI----LTGV------FIWSRRTYVYWQRRRV-KFVQPTHLLGNLSRVL----------- 50
            :|.|:|:    |.|.      ::|....:|:.:.:|: |:::.....||..|:|           
plant     1 MLEIITVRKVFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMD 65

  Fly    51 RLEESFALQLRRFYFDERFRNEPVVGIYLFH---------------QPALLIRDLQLVRTVLVED 100
            ::..|..|.|     |..|.  |.:..:|.|               .|.:::.|.:.:|.::   
plant    66 QVAHSLPLPL-----DADFL--PRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIM--- 120

  Fly   101 FVSFSNRFAKCDGRSDKMGALS-LFLA-----KQPEWREIRTRLAPAFAGAKLKQMFSLMEEIGC 159
              |....|.|     .|:|:.: :||:     :.|:|.:.|:.|.|||....||.:.........
plant   121 --SKHELFPK-----PKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCK 178

  Fly   160 DL--EWYLKRLTRDLRRGDAERGAIVSIKDVCDLYNTDMIASIAF------GLRSYSLRNTQSEI 216
            ::  ||  :||..  .:|..|..:.....|:    ..:|:|..:|      |::.:.::..|.::
plant   179 EMLEEW--ERLAS--AKGTMELDSWTHCHDL----TRNMLARASFGDSYKDGIKIFEIQQEQIDL 235

  Fly   217 GSHCQDLFRPNVRRIIDLFVI--FYLP--KLVPLLRPKLFTEPHAEFLRRVIQLVIEERE----- 272
            |                |..|  .|:|  |.:|....:...|...: :|.:.:.:||.:|     
plant   236 G----------------LLAIRAVYIPGSKFLPTKFNRRLRETERD-MRAMFKAMIETKEEEIKR 283

  Fly   273 -RGGDLRND 280
             ||.|..:|
plant   284 GRGTDKNSD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 53/261 (20%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.