DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and CYP735A1

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:526 Identity:122/526 - (23%)
Similarity:219/526 - (41%) Gaps:83/526 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRV-LRLEESFALQLRRFY 64
            :::.|.||..:...::..::..||.....:::.|...:|..|.||:..: ..:.:|.:......:
plant    11 VIFVTTILRVLYDTISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVSQSASKDCDSIH 75

  Fly    65 FDERFRNEPVVGIYLFH------------------QPALLIRDLQLVRTVLVEDFVSFSNRFAKC 111
            .|       :||..|.|                  .|.|.:.:.:|::.:|::........:.:.
plant    76 HD-------IVGRLLPHYVAWSKQYGKRFIVWNGTDPRLCLTETELIKELLMKHNGVSGRSWLQQ 133

  Fly   112 DGRSDKMGALSLFLAKQPEWREIRTRLAPAFAGAKLKQMFSLMEEIGCDLEWYLKRLTRDLRRGD 176
            .|..:.:|. .|.:|...:|...|...||||.|.:||.....|.|....|   ::||.:::..|.
plant   134 QGTKNFIGR-GLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTSKL---VERLRKEVGEGA 194

  Fly   177 AERGAIVSIKDVCDLYNTDMIASIAFGL---RSYSLRNTQSEIGSHCQDLFR----PNVRRIIDL 234
            .|    |.|.:.......|:|:...||.   :...|.|..:.:...|....|    |..|.:   
plant   195 NE----VEIGEEMHKLTADIISRTKFGSSFEKGKELFNHLTVLQRRCAQATRHLCFPGSRFL--- 252

  Fly   235 FVIFYLPKLVPLLRPKLFTEPHAEFLRRVIQLVIE---------ERERGGDLRNDLIEMLLTLKK 290
                          |..:........:.|.:|:||         |..|.....:||:.:||   .
plant   253 --------------PSKYNREIKSLKKEVERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLL---N 300

  Fly   291 EADLQQDKSHFTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASN 355
            |.|:.::.::..::...:..:..:|..||.||.:..:::....||..|..|.::|.|:||.|.. 
plant   301 EMDIDKNNNNNNNNLQLIMDECKTFFFAGHETTALLLTWTTMLLADNPTWQEKVREEVREVFGR- 364

  Fly   356 PNGRLTYEAVARMEFLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPVFIS 420
             ||..:.:.::::..|..|:.|:||.||...||.|       ..|..|: ..:....:|:.::|.
plant   365 -NGLPSVDQLSKLTSLSKVINESLRLYPPATLLPR-------MAFEDLK-LGDLTIPKGLSIWIP 420

  Fly   421 NLAIHHDPKYW-PDPDRFDPERFSAANKALQAPMSYMPFGAGPRNCIGMQIGLLQIKLGLVYFLH 484
            .|||||..:.| .|.::|:||||  ..:...:...::||.||||||||.|..|::.|:.|...:.
plant   421 VLAIHHSEELWGKDANQFNPERF--GGRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLIS 483

  Fly   485 QHRVEI 490
            :....|
plant   484 KFNFTI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 111/467 (24%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 122/526 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.