DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and CYP71A27

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:471 Identity:98/471 - (20%)
Similarity:181/471 - (38%) Gaps:89/471 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQP--------THLLGNLSRVLRLEESFALQLRRF 63
            |.|.:.|:|..:|:..       ..:|:...:|        ..::|||.::       .....|:
plant     6 ISLCLTTLLAFLFLKP-------LLKRITTTKPKLPPSPWRLPVIGNLHQL-------GPNPHRY 56

  Fly    64 YFDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGALSLFL--- 125
            ......|..|::.::....|.|::....:...::....:.|:||        .|..|:::|:   
plant    57 LHSLSLRYGPLMLLHFGRVPVLVVSCPDVTNDIMKTHDLKFANR--------PKSKAINIFMEGG 113

  Fly   126 ------AKQPEWREIRTRLAPAFAGAKLKQMF-SLMEEIGCDLEWYLKRLTRDLRRGDAERGAIV 183
                  ....:|:.:::.........|:.:.| :|.||       .:|.:|..|....:...::.
plant   114 RDIIFGPYGEDWKSMKSLGVVHLLNNKMVRSFENLREE-------EIKVMTEKLEEASSSSSSVN 171

  Fly   184 SIKDVCDLYNTDMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIIDLFVIFYLPKLVPLL- 247
            ..|.:..|.| |:|..|..| |.|:    :.|.|...::|    |....:.|..|:....:|.| 
plant   172 LSKLLMTLTN-DIICRITLG-RKYN----EEEGGIDIKNL----VMTSSEFFGKFFFGDFIPSLA 226

  Fly   248 ----------RPKLFTEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQQDKS-HF 301
                      :.|........||..::|   |..:......:|.|:|||.      :|:||: .|
plant   227 WIDWISGIDDKMKDINNKLDCFLDSMVQ---EHVDADHKEPSDFIDMLLL------IQKDKTKRF 282

  Fly   302 THHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNGRLTYEAVA 366
            ...|..|.........:|..|.::.:.:.:.||.:.|....:|:.||......|.|  :|.:.|.
plant   283 KFDRSDLILILKDMFFSGTATTASQLEWTMTELMRHPECMKKLQDEINSFSTHNLN--VTEKEVE 345

  Fly   367 RMEFLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPVFISNLAIHHDPKYW 431
            :|.:|..|::|.||.:|..|||.|..:...:.:.|.:        ..|..|.|:..|:..:|..|
plant   346 KMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQLKGYDI--------SAGTHVIINAWALQRNPAIW 402

  Fly   432 P-DPDRFDPERFSAAN 446
            . |.:.:.|||....|
plant   403 GLDANEYRPERHFGTN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 88/411 (21%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 91/437 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.