DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and CYP705A23

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_188649.1 Gene:CYP705A23 / 821557 AraportID:AT3G20140 Length:510 Species:Arabidopsis thaliana


Alignment Length:426 Identity:95/426 - (22%)
Similarity:171/426 - (40%) Gaps:64/426 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGALSLFLAKQPE-WREIRT 136
            |::.:.:|:.|.:.:....:...:.....|:.|.|.......|..:|:...|.|...: |:.::.
plant    76 PLLYLRIFNVPIIFVSSASVAYEIFRGHDVNISFRGNPPIEESLLVGSFGFFTAPYGDYWKFMKK 140

  Fly   137 RLAPAFAGAKLKQMFSLMEEIGCD-LE-WYLKRLTRDLRRGDAERGAIVSIKDVCDLYNTDMIAS 199
            .:.....|   .|.......|..| || :|:..|.:.:::...|.|     |:...|. .|.|..
plant   141 VMVTKLLG---PQALQRSRGIRADALERFYMNLLDKAMKKESVEIG-----KETMKLI-YDSICK 196

  Fly   200 IAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRII--------DLFVIFYLPKLVPLLRPKLF---- 252
            :..| |::|..|.::|           .||.::        .:|:...|.|.:..|...||    
plant   197 MIMG-RNFSEENGEAE-----------RVRGLVTESTALTKKIFMANVLHKPLKKLGISLFKKEI 249

  Fly   253 ---TEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTL--KKEADLQQDKSHFTHHRDFLAAQA 312
               :....|.|.|.  ||..|.:...|...|::.:||..  .|.|:.:..::|       :.:..
plant   250 MDVSNSFDELLERF--LVEHEEKLNEDQDMDMMGVLLAACRDKNAECKITRNH-------IKSLF 305

  Fly   313 ASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNGRLTYEA-VARMEFLDMVVE 376
            ....|||.:|...:..:.:.|:..:|.:..::|.||.......   ||..|. :..:.:|...|:
plant   306 VDLVVAGTDTSRHATQWTMAEIINKPKVLEKVREEIYSVVGRT---RLVQETDLPSLPYLQATVK 367

  Fly   377 ETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPVFISNLAIHHDPKYWPDPDRFDPER 441
            |.||.:|..||..|     ..:..:|:   ...|.....|:.::..|:..||..|.||:.|.|||
plant   368 EGLRLHPPGPLFAR-----TAREGFSV---GGFYVPENTPLVVNAYAMMRDPGSWEDPNEFKPER 424

  Fly   442 FSAANK--ALQAPMSYMPFGAGPRNCIGMQIGLLQI 475
            |..:.|  ..:..:.|:|||:|.|.|.|:.:..:.:
plant   425 FLGSGKEDEREHGLKYIPFGSGRRGCPGINLAYILV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 95/426 (22%)
CYP705A23NP_188649.1 p450 26..504 CDD:386267 95/426 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.