DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and CYP705A9

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_180269.1 Gene:CYP705A9 / 817243 AraportID:AT2G27010 Length:498 Species:Arabidopsis thaliana


Alignment Length:508 Identity:111/508 - (21%)
Similarity:196/508 - (38%) Gaps:112/508 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTH-----LLGNLSRVLRLEESFALQ-LRRFY 64
            |.|:.|:..|.....:|    .::::.:..|..|..     ::|:|..:|.|....:|| |...|
plant     7 NCLILILLCLLSFLCYS----FFFKKPKDGFNLPPSPPSLPIIGHLHHLLSLFMHRSLQKLSSKY 67

  Fly    65 FDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGALSLFLAKQP 129
                   .|::.:::|:.|.||:....:...:.....|:.|:|....:..|...|:.....|...
plant    68 -------GPLLYLHVFNVPILLVSSPSIAYEIFRTQDVNVSSRDFPTNEGSLLFGSFGFGTAPSS 125

  Fly   130 EWREIRTRLAPAFAGAKLKQMFSLMEEIGCDLEWYLKRLTRDLRRGDAERGAIVSIKDVCDLYNT 194
            ..:..|        |.|.....|          :||..|.:.:::...|     ..::...|.| 
plant   126 GLKHSR--------GHKKSVQRS----------YYLNLLDKAVKKESVE-----IAEEAMKLVN- 166

  Fly   195 DMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIID----LFVIFYLPKLV--PL------L 247
            :.:..:..| ||.|..|.::|           .||.::.    |...|.|..::  ||      |
plant   167 NTVCQMIMG-RSCSEENGEAE-----------RVRGLVTKTDALTKKFILAGILRKPLQKIGISL 219

  Fly   248 RPKLFTEPHAEFLRRVIQLV-------IEERERGGDLRNDLIEMLLTLKKEADLQQDKSHFTHHR 305
            ..|...:...:| ..|::.:       :||..:|.|:.:.|:|:         ...:|:.:...|
plant   220 FKKELMDASCKF-NEVLEKILVEYKEKVEEHHQGTDMMDKLLEV---------YGDEKAEYKITR 274

  Fly   306 DFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNGRLTYEA-VARME 369
            |.:.:.......||.:|.:.::.:.:.|:.....:..|||.||.......   ||..|. :..:.
plant   275 DHIKSLFVDLFFAGTDTWTHAIQWIMAEIINNSYILERLREEIDSVVGKT---RLIQETDLPNLP 336

  Fly   370 FLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPV------FISNLAIHHDP 428
            .|...|:|.||.:|.|||:              ||...|..|..|..|      .::..|:..||
plant   337 CLQATVKEGLRLHPPVPLV--------------LRTFKEGCTIGGFYVPEKTTLVVNGYAMMRDP 387

  Fly   429 KYWPDPDRFDPERFSAANKALQAP------MSYMPFGAGPRNCIGMQIGLLQI 475
            :||.||..|.||||.|::::.|..      :.|:|||.|.|.|.|..:..:.:
plant   388 EYWEDPQEFKPERFLASSRSSQNDEIRDELLKYLPFGNGRRACPGANLAYISV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 99/450 (22%)
CYP705A9NP_180269.1 p450 46..486 CDD:299894 104/465 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.