DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and CYP705A8

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:526 Identity:115/526 - (21%)
Similarity:207/526 - (39%) Gaps:122/526 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTH-----LLGNLSRVLRLEESFALQ-LRRFY 64
            |.|:.|:..|..:..:|    .::::.:..|..|..     ::|:|..:|.|....:|| |...|
plant    11 NCLILILLCLLSILCYS----FFFKKPKDGFNLPPSPPSLPIIGHLHHLLSLFMHRSLQKLSSKY 71

  Fly    65 FDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGALSLFLAKQP 129
                   .|::.:::|:.|.||:....:...:.....|:.|.|....:..|..:|:.|...|...
plant    72 -------GPLLYLHVFNVPILLVSSPSIAYEIFRAQDVNVSTRDFPTNEGSLFLGSFSFITAPYG 129

  Fly   130 E-WREIRTRLAPAFAGAKLKQMFSLMEEIGCDLEWYLKRLTRDLRRGDAER-----------GAI 182
            | |:.::..:.....|.:.                 |:|..| :|..:.||           ...
plant   130 EYWKFMKKLIVTKLLGPQA-----------------LERSQR-IRANEVERFYSNLLDKAMKKES 176

  Fly   183 VSIKDVCDLYNTDMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIID----LFVIFYLPKL 243
            |.|.|.......::|..:..| |:.|..|.::|           .:|.::.    |...|.|..:
plant   177 VEIADEAMKLVNNIICKMIMG-RTCSEENGEAE-----------RIRGLVTKSDALLKKFLLAAI 229

  Fly   244 V--PL------LRPKLFTEPHAEFLRRVIQLVIEERER------GGDLRNDLIEMLLTLKKEADL 294
            :  ||      |..|:|.:...:|...:.::::|..||      |.|:.:.|:|          :
plant   230 LRKPLKKIGITLFKKVFMDISLKFDEVLEKILVENEERLEENQQGTDIMDKLLE----------V 284

  Fly   295 QQDK-SHFTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNG 358
            ..|| |.:...||.:.:.......||.:|.:.::.:.:.|:....|:..|||.||.......   
plant   285 YGDKTSEYKITRDHIKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGKT--- 346

  Fly   359 RLTYEA-VARMEFLDMVVEETLRKYPIVPLLERE----CT----PINKKRFYSLRPHAECYTRRG 414
            ||..|. :..:.:|...|:|.||.:|.:||:.|.    ||    .|.||                
plant   347 RLIQETDLPNLLYLQATVKEGLRLHPTIPLVLRTFQDGCTIGGFSIPKK---------------- 395

  Fly   415 MPVFISNLAIHHDPKYWPDPDRFDPERFSAANKALQAP------MSYMPFGAGPRNCIGMQIGLL 473
            ..:.::..||..||..|.||..|.||||.|::::.|..      :.|:.||:|.|.|.|:.:..:
plant   396 TKLVVNGYAIMRDPDNWEDPLEFKPERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYV 460

  Fly   474 QIKLGL 479
            .::..:
plant   461 SVETAI 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 103/468 (22%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 106/478 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.