DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and AT3G32047

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001030796.1 Gene:AT3G32047 / 3769237 AraportID:AT3G32047 Length:502 Species:Arabidopsis thaliana


Alignment Length:387 Identity:87/387 - (22%)
Similarity:165/387 - (42%) Gaps:68/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LKRLTRDLRRGDAER-----------GAIVSI-KDVCDLYNTDMIASIAFGLRSYSLRNTQSEIG 217
            |:|| |.:|..:.||           |..|.| |:...|.| :.:..:..|      |:...|.|
plant   152 LERL-RHVREDELERFHTNLLSKEMKGETVQIAKEAIKLTN-NSVCKMIMG------RSCLEENG 208

  Fly   218 --SHCQDLFRPNVRRIIDLFVIFYLPKLVPLLRPKLF-------TEPHAEFLRRVIQLVIEERER 273
              :..:.|.......:..:|:...|.:|..:|...||       :....|||.:::   :|..|:
plant   209 DAARVRGLVTETFALVKKIFLTQVLRRLFEILGISLFKKEILGVSRKFDEFLEKIL---VEHDEK 270

  Fly   274 GGDLRNDLIEMLLTLKKEADLQQDKSHFTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQP 338
            ......|::::||     |..:.:.:.:...|:.:.:..|...:.|.:|.:.::.:.:.|:..:|
plant   271 PDFQGGDMMDVLL-----AAYRDENAEYKITRNHIKSLFAELILGGTDTSAQTIEWTMAEIINKP 330

  Fly   339 LMQSRLRREIREAFASNPNGRLTYEA-VARMEFLDMVVEETLRKYPIVPLLERE----CTPINKK 398
            .:..:||:|:.......   ||..|. :..:.:|..||:|.||.:|..|:..|:    ||     
plant   331 NILEKLRKELDSVVGKT---RLIEEKDLPNLPYLQSVVKEGLRLHPPAPVFGRKVLEGCT----- 387

  Fly   399 RFYSLRPHAECYTRRGMPVFISNLAIHHDPKYWPDPDRFDPERF----SAANKALQAPMSYMPFG 459
                ::.:   |..:...:.::..|:..||.||.|||.|.||||    |...:..:..:.|:|||
plant   388 ----IKGY---YVPKNTALVVNAYAVMRDPHYWEDPDEFKPERFLTTSSKKEEEREQELKYIPFG 445

  Fly   460 AGPRNCIGMQIGLLQI--KLGLVYFLHQHRVEICDRTVERIQFDAKFALLASEQRIYLKVDC 519
            :|.|.|.|:.:|.:.:  .:|::......||:     .:::..|...|.|.....:..:..|
plant   446 SGRRGCPGVNLGYIFVGTAIGMMVHCFDWRVK-----GDKVNMDETAAALTLNMAVGRRDTC 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 86/383 (22%)
AT3G32047NP_001030796.1 p450 59..496 CDD:299894 86/379 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.