DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and Cyp3a23-3a1

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_037237.2 Gene:Cyp3a23-3a1 / 25642 RGDID:628626 Length:502 Species:Rattus norvegicus


Alignment Length:535 Identity:165/535 - (30%)
Similarity:261/535 - (48%) Gaps:67/535 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRVLRLEESFALQLRRFYF 65
            :...|.:|||:|.:|  ::.:..||:..::::.:...:|....|.:.       ::.:.|.:|..
  Rat     7 LTLETWVLLAVVLVL--LYGFGTRTHGLFKKQGIPGPKPLPFFGTVL-------NYYMGLWKFDV 62

  Fly    66 DERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVED-FVSFSNRFAKCDGRSDKMGALSLFLAKQP 129
            :...:...:.|::....|...|.|.::::.|||:: |..|:||  :..|....||. ::.::|..
  Rat    63 ECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNR--RDFGPVGIMGK-AISVSKDE 124

  Fly   130 EWREIRTRLAPAFAGAKLKQMFSLMEEIGCDLEWYLKRLTRDLRRGDAERGAIVSIKDVCDLYNT 194
            ||:..|..|:|.|...:||:||.::|:.|..|..||::          |:|..|.:|:|...|:.
  Rat   125 EWKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQ----------EKGKPVPVKEVFGAYSM 179

  Fly   195 DMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIIDLF-VIFYLPKLVPLLRPK-------L 251
            |:|.|.:||:...||.|.:.......:.|.|      ||.| .:|....|.|.|.|.       :
  Rat   180 DVITSTSFGVNVDSLNNPKDPFVEKAKKLLR------IDFFDPLFLSVVLFPFLTPVYEMLNICM 238

  Fly   252 FTEPHAEFLRRVIQLVIEER-ERGGDLRNDLIEMLLTLKKEADLQQDKSHFTHHRDF-LAAQAAS 314
            |.:...||.::.:..:.|.| :.....|.|.:::::....::   :||...|...|. :.||:..
  Rat   239 FPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDS---KDKESHTALSDMEITAQSII 300

  Fly   315 FEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPN-GRLTYEAVARMEFLDMVVEET 378
            |..||.|..|:::||.|:.||..|..|.:|:.||..|.   || ...||:.|..||:||||:.||
  Rat   301 FIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRAL---PNKAPPTYDTVMEMEYLDMVLNET 362

  Fly   379 LRKYPIVPLLEREC---TPINKKRFYSLRPHAECYTRRGMPVFISNLAIHHDPKYWPDPDRFDPE 440
            ||.|||...|||.|   ..||           ..:..:|..|.|.:.|:|.||::||:|:.|.||
  Rat   363 LRLYPIGNRLERVCKKDVEIN-----------GVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPE 416

  Fly   441 RFSAANKALQAPMSYMPFGAGPRNCIGMQIGLLQIKLGLVYFLHQHRVEICDRTVERIQFDAKFA 505
            |||..||....|..|:|||.||||||||:..|:.:||.|...|.....:.|..|    |...|.:
  Rat   417 RFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKET----QIPLKLS 477

  Fly   506 ---LLASEQRIYLKV 517
               ||...:.|.|||
  Rat   478 RQGLLQPTKPIILKV 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 153/475 (32%)
Cyp3a23-3a1NP_037237.2 p450 39..492 CDD:278495 155/499 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.