DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6v1 and LOC105945483

DIOPT Version :9

Sequence 1:NP_001285499.1 Gene:Cyp6v1 / 33056 FlyBaseID:FBgn0031126 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_031756601.1 Gene:LOC105945483 / 105945483 -ID:- Length:492 Species:Xenopus tropicalis


Alignment Length:470 Identity:123/470 - (26%)
Similarity:198/470 - (42%) Gaps:75/470 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LLGNLSRVLRLEESFALQLRRFY-FDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFS 105
            :|||:     |:..|:..|:... |.|.:  .||..|||...||:::|.|:.::.|||.....|:
 Frog    36 VLGNI-----LQMDFSNPLKDLQKFSEVY--GPVYSIYLGFTPAVVVRGLKSIKEVLVNKGTDFA 93

  Fly   106 ----NRFAKCDGRSDKMGALSLFLAKQPE-WREIR--TRLAPAFAGAKLKQMFSLMEEIGCDLEW 163
                ||......:|.     .|.:|...: |:|.|  |.......|...|.|...::|....|..
 Frog    94 GRPQNRITDVISKSK-----GLVVAPYGQAWKEHRRFTLSTLRSFGLGKKSMEDRIQEENMHLIQ 153

  Fly   164 YLKRLTRDLRRGDAERGAIVSIKDVCDLYN---------TDMIASIAFGLRSYSLRNTQSEIGSH 219
            ..|                 :.|||  |::         :::|.||.|| |.|...:|..:   :
 Frog   154 AFK-----------------NSKDV--LFDPHFVLENAVSNIICSIVFG-RRYDYNDTSFQ---N 195

  Fly   220 CQDLFRPNVRRI----IDLFVIFYLPKLVPLLRPKLFTEPHA--EFLRRVIQLVIEERER--GGD 276
            ..:|...|::..    ..|:..|...:.:||...|:|.....  .||.:|::   |.:|.  .|:
 Frog   196 ILNLVHENMKLATGFWAQLYNAFGFIQFLPLPHKKIFQNVDVVFAFLGKVVE---EHKETLLPGE 257

  Fly   277 LRNDLIEMLLTLKKEADLQQDKSHFTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQ 341
            .|:.:...|..|||:.  ::|.:..|...:.|.:..|...|||.||.::|:.:.|..:.|.|.:|
 Frog   258 PRDYIDCYLEELKKKQ--EEDGNKMTFDEENLFSCVADLFVAGTETTTSSLEWCLLYMLKFPEIQ 320

  Fly   342 SRLRREIREAFASNPNGRLTYEAVARMEFLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPH 406
            .:...||...| .|.| .|.||...||.:...|::|..|...:|||.... :||........   
 Frog   321 EKCHEEIDRVF-GNKN-CLEYEDRERMPYTQAVLQEVQRHASVVPLGVSH-SPIRDVHLNGF--- 379

  Fly   407 AECYTRRGMPVFISNLAIHHDPKYWPDPDRFDPERFSAANKALQAPMSYMPFGAGPRNCIGMQIG 471
               :..:|..:.....::|:|..:|..|..|:||.|...|..|....:::||.||||.|:|..:.
 Frog   380 ---FIPKGTVIITDLSSVHYDKTHWKYPHEFNPENFLNENGELIKTEAFLPFSAGPRVCLGENLA 441

  Fly   472 LLQIKLGLVYFLHQH 486
            .::|.|.....| ||
 Frog   442 RMEIFLFFTAML-QH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6v1NP_001285499.1 p450 59..517 CDD:299894 118/453 (26%)
LOC105945483XP_031756601.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.