DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and RUNX3

DIOPT Version :9

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001026850.1 Gene:RUNX3 / 864 HGNCID:10473 Length:429 Species:Homo sapiens


Alignment Length:400 Identity:150/400 - (37%)
Similarity:192/400 - (48%) Gaps:72/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PENLIERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRA 167
            ||  :...||| ||:|.||||:|.||:.:|:.||:|||.|||||:||||:|||:|.|||:||:.|
Human    64 PE--VRSMVDV-LADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMA 125

  Fly   168 GNDENFCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDG 232
            |||||:..||||.:||||||||:||||||||||||||||||||.:.|||.|:|||.:||||||||
Human   126 GNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDG 190

  Fly   233 PREPRSKVRHQ-----GFHPFAFGPQRFGPDPLMAGLPFKLPGFAHHLVGMHSHLHAPDWRAHMA 292
            |||||   ||:     ...||   |.|||.               ...:.|......|..|..::
Human   191 PREPR---RHRQKLEDQTKPF---PDRFGD---------------LERLRMRVTPSTPSPRGSLS 234

  Fly   293 LGGRPAAFTAAPFFG-----------HHAAAFPTASGLRGLSGDSQQHQQQQQQHQLATVGAAHS 346
            .....::....|..|           ....:|||...|      ::......:.|....:.||. 
Human   235 TTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTL------TESRFPDPRMHYPGAMSAAF- 292

  Fly   347 TTSPEGSPTTTTTSGTQLSAF--VQPPMTSS------PPPVTSLQHDNNNNNSNNNNSSSHIDAG 403
                   |.:.|.|||.:|:.  ...|.||.      |||..... .|.:.....|.|..|:..|
Human   293 -------PYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAP-QNQSGPFQANPSPYHLYYG 349

  Fly   404 FESDSISVTGSPRKSLGSPLTHDEEEAEAEAEAEAEAEAEAEEAEVGGLSRNGGGIQGPLHSESS 468
            ..|.|...:.....|.|...:.....|...:.|.:.|........:||.|   .|::......:|
Human   350 TSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS---DGVEADGSHSNS 411

  Fly   469 PGSGGAFTAL 478
            |      |||
Human   412 P------TAL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 90/120 (75%)
RUNX3NP_001026850.1 Runt 76..197 CDD:307137 90/123 (73%)
Atrophin-1 <191..325 CDD:331285 35/168 (21%)
RunxI 330..429 CDD:312115 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3652
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8468
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.