DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and Runx1

DIOPT Version :9

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:XP_017453542.1 Gene:Runx1 / 50662 RGDID:2283 Length:464 Species:Rattus norvegicus


Alignment Length:405 Identity:141/405 - (34%)
Similarity:188/405 - (46%) Gaps:120/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRAGNDEN 172
            :|::..:||:||||||:|.||:.:|:.||||||.||||||||||:|||:|.|||:||:.||||||
  Rat    62 DRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDEN 126

  Fly   173 FCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDGPREP- 236
            :..||||.||.||||||:||||||||||||||||||||.:.|||.|:|||.:|||:|||||||| 
  Rat   127 YSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR 191

  Fly   237 ----------------------------RSKVRHQGFHP-------------FAFGPQ------- 253
                                        |:.:|....||             .||.||       
  Rat   192 RHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQD 256

  Fly   254 --RFGPDP-----------------LMAGLPFKLPGFAHHLVGMHSHLH-----APDWRAHMALG 294
              :..|.|                 :....|.. ||.|..:..:.:.|.     |||..|.    
  Rat   257 ARQIQPSPPWSYDQSYQYLGSITSSVHPATPIS-PGRASGMTSLSAELSSRLSTAPDLTAF---- 316

  Fly   295 GRPAAFTAAPFFG----HHAAAF----PTAS----GLRGLSGDSQQHQQQQQQHQLATVGAAHST 347
            |.|..|...|...    |:..||    |..|    |:..:|..|:.|......:.    |::.:.
  Rat   317 GDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSTSRYHTYLPPPYP----GSSQAQ 377

  Fly   348 TSP--EGSPTTTTTSGTQLSAF-------------VQPPMT-----------SSPPPVTSLQHDN 386
            ..|  .|||:.....||...::             :.||.|           |.|.....::.:.
  Rat   378 AGPFQTGSPSYHLYYGTSAGSYQFSMVGGERSPPRILPPCTNASTGAALLNPSLPSQSDVVETEG 442

  Fly   387 NNNNSNNNNSSSHID 401
            :::||..|...:.::
  Rat   443 SHSNSPTNMPPARLE 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 92/149 (62%)
Runx1XP_017453542.1 Runt 68..194 CDD:395684 93/125 (74%)
RunxI 374..464 CDD:400691 14/84 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2685
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X738
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.