DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and rnt-1

DIOPT Version :9

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001370335.1 Gene:rnt-1 / 172243 WormBaseID:WBGene00004393 Length:301 Species:Caenorhabditis elegans


Alignment Length:313 Identity:97/313 - (30%)
Similarity:136/313 - (43%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRAGNDENFCGELRNCTAVMKN 186
            |.|:.||:::.|.||.||||||:....|.|:.|..|.|.|.|:|.|||||..|.|:||..|.:..
 Worm    22 LEKSSSPNILYTALPKHWRSNKSFQEPFYVVLLTPVPDNTEVSIWAGNDEKPCEEVRNEKAKVHR 86

  Fly   187 QVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDGPRE-----PRSKVRHQGFH 246
            |||||||||||||||||:.|.|||||.:.|:.:||....|||||||||:     |:..::.|...
 Worm    87 QVAKFNDLRFVGRSGRGRKFHLTIVIHSAPMMVATVKNVIKVTVDGPRDARIPKPQGSLKRQAEQ 151

  Fly   247 ----------------PFAFGPQRFGPDPLMAGLPFKLPGFAHHLV--GMHSHLHAPDWRAHMAL 293
                            |....|..:.|.|:....|   |.| ..|:  |.|..:.|..|:.|   
 Worm   152 QTIFPNDIIRTPGPPMPMTMIPPPWFPLPMTQTFP---PSF-FPLISPGPHPSISAALWKIH--- 209

  Fly   294 GGRPAAFTAAPFFGHHAAAFPTASGLRGLSGDSQQHQQQQQQHQLATVGAAHSTTSPE------- 351
                                         |...:...:|:.:.:..::..:...:||.       
 Worm   210 -----------------------------SESMKTPIKQKVEQENVSLNTSTCLSSPSIFITPTS 245

  Fly   352 --------GSPTTTTTSGTQLSAFVQPPMTSSPPPVTSLQHDNNNNNSNNNNS 396
                    .||.:.|.|.......:|    .:|..|.|.:..|.:..|:|::|
 Worm   246 DDRKLKRPSSPRSITKSSETSINLIQ----ETPESVESKRRRNVSITSSNSSS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 67/121 (55%)
rnt-1NP_001370335.1 Runt 22..137 CDD:395684 66/114 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - otm14562
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.