DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RunxB and Runx3

DIOPT Version :9

Sequence 1:NP_001259745.1 Gene:RunxB / 33051 FlyBaseID:FBgn0259162 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_569109.1 Gene:Runx3 / 156726 RGDID:620082 Length:409 Species:Rattus norvegicus


Alignment Length:394 Identity:147/394 - (37%)
Similarity:190/394 - (48%) Gaps:71/394 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PENLIERTVDVLLAEHPGELVKTGSPHVVCTTLPTHWRSNKTLPIAFKVLALGEVMDGTIVTIRA 167
            ||  :...||| ||:|.||||:|.||:.:|:.||:|||.|||||:||||:|||:|.|||:||:.|
  Rat    51 PE--VRSMVDV-LADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMA 112

  Fly   168 GNDENFCGELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTIVISTNPIQIATYTKAIKVTVDG 232
            |||||:..||||.:||||||||:||||||||||||||||||||.:.|||.|:|||.:||||||||
  Rat   113 GNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDG 177

  Fly   233 PREP---RSKVRHQGFHPFAFGPQRFGPDPLMAGLPFKLPGFAHHLVGMHSHLHAPDWRAHMALG 294
            ||||   |.|:..|   ..|| |.||| |..|...|                 ..|..|..::..
  Rat   178 PREPRRHRQKIEDQ---TKAF-PDRFG-DLRMRVTP-----------------STPSPRGSLSTT 220

  Fly   295 GRPAAFTAAPFFG-----------HHAAAFPTASGLRGLSGDSQQHQQQQQQHQLATVGAAHSTT 348
            ...::....|..|           ....:|||...|      ::....:.:.|....:.||.   
  Rat   221 SHFSSQAQTPIQGSSDLNPFSDPRQFDRSFPTLQSL------TESRFPEGRMHYPGAMSAAF--- 276

  Fly   349 SPEGSPTTTTTSGTQLSAFVQPPMTSS--------PPPVTSLQHDNNNNNSNNNNSSSHIDAGFE 405
                 |.:.|.|||.|.......|.:|        |||..... .:.:.....|.:..|:..|..
  Rat   277 -----PYSATPSGTSLGGLSVAGMPASSRFHHTYLPPPYPGAP-QSQSGPFQANPAPYHLFYGTS 335

  Fly   406 SD----SISVTGSPRKSLGSPLTHDEEEAEAEAEAEAEAEAEAEEAEVGGLSRNGGGIQGPLHSE 466
            |.    |::..|...:|....||    .....|...|.........:..|:..:|.....|. :.
  Rat   336 SGSYQFSMAAAGGGERSPTRMLT----SCPTGASVSAGNLMNPSLGQADGVEADGSHSNSPT-AL 395

  Fly   467 SSPG 470
            |:||
  Rat   396 STPG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RunxBNP_001259745.1 Runt 118..239 CDD:279225 90/123 (73%)
Runx3NP_569109.1 Runt 63..184 CDD:279225 89/120 (74%)
RunxI 314..409 CDD:285676 17/92 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2685
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X738
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.