DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and AT1G19470

DIOPT Version :10

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_173379.1 Gene:AT1G19470 / 838531 AraportID:AT1G19470 Length:412 Species:Arabidopsis thaliana


Alignment Length:258 Identity:56/258 - (21%)
Similarity:96/258 - (37%) Gaps:72/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 SLNAVGTQHLYAVGGILDDDNEEALRMISNVERYDIAKNVWTYMPSLQENRSQHAGVVVGDKLYI 462
            |:..|| |.:|.:||:||      :|.:..:...|...:....:||::..|.:.|..||..|:|:
plant   149 SVVTVG-QEMYVIGGLLD------IRRLQLMTLIDCRTHKCRSLPSMKRGRYKAAAGVVDGKIYV 206

  Fly   463 SGGVHLANILASMW--VFDTKTEVWQELASMPTP---------CCDHVLVAVDNRIYACGG---- 512
            .||..:....|. |  |||.||::|:   |:|.|         ...|.:  :::::|..|.    
plant   207 IGGFRMRKPDAE-WIEVFDLKTQIWE---SLPGPYPRTSAGSQFSAHAV--MEDKLYMLGSKFCL 265

  Fly   513 ---------WHESLTE------W-----------------RVLVEHIYAYDIETNTW---SVETK 542
                     |..|:..      |                 |.|...|..|..:..||   ..|:.
plant   266 VYEPKRNGEWDASVGATPLKDLWDKTCCVVDDMLYTTDPRRTLGHPIVVYHPKDKTWRPVKGESL 330

  Fly   543 IPAPKFYTGVTAM---GRTIFFVGGLDS---TESIDRASAETMAYDLDTKEW---WHEKDSWD 596
            ...|.::...:.|   |..:..:|...|   .:.|.......:..:|:.:|.   |.:.:|.|
plant   331 WSLPSYFFSKSEMANFGGKLVILGSNKSYVTGDCIGEKGIWCVMIELEKREGGEIWGKVESLD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB_POZ 33..151 CDD:453885
PHA03098 46..588 CDD:222983 52/245 (21%)
KELCH repeat 344..390 CDD:276965
KELCH repeat 394..444 CDD:276965 12/45 (27%)
KELCH repeat 448..492 CDD:276965 17/45 (38%)
KELCH repeat 495..539 CDD:276965 12/82 (15%)
AT1G19470NP_173379.1 F-box_SF 57..98 CDD:459239
NanM 136..325 CDD:442289 44/188 (23%)
KELCH repeat 147..188 CDD:276965 12/45 (27%)
KELCH repeat 192..236 CDD:276965 18/47 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.