DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and AT1G16250

DIOPT Version :9

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001321591.1 Gene:AT1G16250 / 838194 AraportID:AT1G16250 Length:383 Species:Arabidopsis thaliana


Alignment Length:360 Identity:71/360 - (19%)
Similarity:115/360 - (31%) Gaps:140/360 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 WNG-----LT----NVIMCFSPKKMNWYELTAIPHID----QCNFGTAVLNNKLFIVGGAYDVFL 366
            |:|     ||    |..:.:.|:...|:.|.....:.    ...|....::|.|.::||      
plant    57 WSGSWLFVLTERSKNQWVAYDPEADRWHPLPRTRAVQDGWHHSGFACVCVSNCLLVIGG------ 115

  Fly   367 KEYIHPFGFCYCPLRNTWMTIAPIQQDRCRFSLNAVGTQHLYAVGGILDDDNEEALRMISNVERY 431
                     ||.|..:::....|:                                 :..:|.|:
plant   116 ---------CYAPSVSSFPHQKPV---------------------------------VTKDVMRF 138

  Fly   432 DIAKNVWTYMPSLQENRSQHAGVVVGDKLYISGGVHLANI--LASMWVFDTKTEVWQELASMPTP 494
            |..|..|..:.|::..|:..|...|..|:|::||.:|.:.  :.|..|:|...:.|:||.:||.|
plant   139 DPFKKQWKMVASMRTPRTHFACTSVSGKVYVAGGRNLTHSRGIPSAEVYDPVADRWEELPAMPRP 203

  Fly   495 ---C-------CDHVL----------------------------------------VAVDNRIYA 509
               |       |.|||                                        |..::|:|.
plant   204 QMDCSGLSYRGCFHVLSDQVGFAEQNSSEVFNPRDMTWSTVEDVWPFSRAMQFAVQVMKNDRVYT 268

  Fly   510 CGGWHESLTEWRVLVEHIYAYDIETNTWSVETKIPA------PK----FYTGVTAMGRTIFFVGG 564
            ...|.|||.:.|         |.:...|.....:|:      |:    |..|..|:...::.:||
plant   269 IVDWGESLIKTR---------DTDEGEWYNVGSVPSVVLPNHPRELEAFGYGFAALRNELYVIGG 324

  Fly   565 --LDSTES------IDRASAETMAYDLDTKEWWHE 591
              |...||      |.|.....:...||....|.|
plant   325 KVLKWEESGAGRFDIVRLPVVRVCNPLDRPLNWRE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB 38..142 CDD:279045
PHA03098 46..588 CDD:222983 69/355 (19%)
BACK 151..249 CDD:285009
KELCH repeat 344..390 CDD:276965 8/45 (18%)
KELCH repeat 394..444 CDD:276965 5/49 (10%)
Kelch 406..458 CDD:128874 9/51 (18%)
Kelch_1 448..492 CDD:279660 14/45 (31%)
KELCH repeat 448..492 CDD:276965 14/45 (31%)
Kelch_1 494..539 CDD:279660 16/94 (17%)
KELCH repeat 495..539 CDD:276965 15/90 (17%)
AT1G16250NP_001321591.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.