DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and AT5G49000

DIOPT Version :10

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001119398.1 Gene:AT5G49000 / 834959 AraportID:AT5G49000 Length:372 Species:Arabidopsis thaliana


Alignment Length:187 Identity:46/187 - (24%)
Similarity:79/187 - (42%) Gaps:48/187 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 IAPIQQDRCR-FSLNAVGTQHLYAVGGILDDDNEEALRMISNVERYDIAKNVWTYMPSLQENRSQ 450
            :|||...... .|:.|:|: ::||:||.:::...      |.|...|...:.|...||::..|:.
plant   112 LAPIPNHHSHSSSIVAIGS-NIYAIGGSIENAPS------SKVSILDCRSHTWHEAPSMRMKRNY 169

  Fly   451 HAGVVVGDKLYISGGVHLANILASMW--VFDTKTEVWQELASMPTPCCDHVL---VAVDNRIYAC 510
            .|..||..|:|::||  |....:|.|  |||.||:.|:.:.|   |..:..:   :.::..||..
plant   170 PAANVVDGKIYVAGG--LEEFDSSKWMEVFDIKTQTWEFVLS---PLAERFIYRSLVIEGEIYIF 229

  Fly   511 G----------------GWHESLT------EWRVLVEHIYA--------YDIETNTW 537
            |                |.|:|:.      .:.|:...:|.        |:.|..:|
plant   230 GDKVVTYKPKEDRWGGVGEHQSMDLGLFFHSYCVIDNVLYCYRPGGIKWYESEKRSW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB_POZ 33..151 CDD:453885
PHA03098 46..588 CDD:222983 46/187 (25%)
KELCH repeat 344..390 CDD:276965 1/2 (50%)
KELCH repeat 394..444 CDD:276965 12/50 (24%)
KELCH repeat 448..492 CDD:276965 18/45 (40%)
KELCH repeat 495..539 CDD:276965 11/76 (14%)
AT5G49000NP_001119398.1 F-box_AtAFR-like 23..65 CDD:438923
NanM 112..>243 CDD:442289 38/142 (27%)
KELCH repeat 121..163 CDD:276965 12/48 (25%)
KELCH repeat 167..212 CDD:276965 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.