| Sequence 1: | NP_608397.1 | Gene: | CG1812 / 33049 | FlyBaseID: | FBgn0031119 | Length: | 616 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001346357.1 | Gene: | Klhdc8b / 78267 | MGIID: | 1925517 | Length: | 354 | Species: | Mus musculus |
| Alignment Length: | 243 | Identity: | 61/243 - (25%) |
|---|---|---|---|
| Similarity: | 101/243 - (41%) | Gaps: | 43/243 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 339 PHIDQCN-FGT-AVLNNKLFIVGGAYDVFLKEYIHPFGFCYCPL---------RNTWMTIAPIQQ 392
Fly 393 DRCRFSLNAVGTQHLYAVGGILDDDNEEALRMISNVERYDIAKNVWTYMPSLQENRSQHAGVVVG 457
Fly 458 DKLYISGGV-----HLANILASMWVFDTKTEVWQELASMPTPCCDHVLVAVDNRIYACGGWHESL 517
Fly 518 TEWRVLVEHIYAYDIETNTWSVETKIPAPKFYTGVTAMGRTIFFVGGL 565 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1812 | NP_608397.1 | BTB | 38..142 | CDD:279045 | |
| PHA03098 | 46..588 | CDD:222983 | 61/243 (25%) | ||
| BACK | 151..249 | CDD:285009 | |||
| KELCH repeat | 344..390 | CDD:276965 | 13/56 (23%) | ||
| KELCH repeat | 394..444 | CDD:276965 | 11/49 (22%) | ||
| Kelch | 406..458 | CDD:128874 | 11/51 (22%) | ||
| Kelch_1 | 448..492 | CDD:279660 | 11/48 (23%) | ||
| KELCH repeat | 448..492 | CDD:276965 | 11/48 (23%) | ||
| Kelch_1 | 494..539 | CDD:279660 | 14/44 (32%) | ||
| KELCH repeat | 495..539 | CDD:276965 | 13/43 (30%) | ||
| Klhdc8b | NP_001346357.1 | Kelch 1 | 1..31 | 5/15 (33%) | |
| PHA03098 | <7..210 | CDD:222983 | 55/221 (25%) | ||
| KELCH repeat | 21..66 | CDD:276965 | 13/56 (23%) | ||
| Kelch 2 | 32..79 | 11/58 (19%) | |||
| KELCH repeat | 69..113 | CDD:276965 | 11/49 (22%) | ||
| Kelch 3 | 81..127 | 11/51 (22%) | |||
| KELCH repeat | 117..162 | CDD:276965 | 11/48 (23%) | ||
| Kelch 4 | 128..175 | 14/50 (28%) | |||
| PHA03098 | <129..336 | CDD:222983 | 32/111 (29%) | ||
| KELCH repeat | 165..210 | CDD:276965 | 13/49 (27%) | ||
| Kelch 5 | 176..222 | 13/50 (26%) | |||
| KELCH repeat | 212..262 | CDD:276965 | 5/19 (26%) | ||
| Kelch 6 | 224..281 | 4/7 (57%) | |||
| KELCH repeat | 271..317 | CDD:276965 | |||
| Kelch 7 | 282..329 | ||||
| Kelch 8 | 331..354 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||