DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and KLHDC8A

DIOPT Version :9

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001258792.1 Gene:KLHDC8A / 55220 HGNCID:25573 Length:350 Species:Homo sapiens


Alignment Length:333 Identity:81/333 - (24%)
Similarity:135/333 - (40%) Gaps:69/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 IGGFEWNGLTNVIMCF---SPKKMNWYELTAIPHIDQCNFGTAV--LNNKLFIVGGAYDVFLKEY 369
            |||.:.||:.  :.||   ||:...|   ||:|.:.....|.||  |..::.::||.        
Human    36 IGGCDDNGVP--MDCFEVYSPEADQW---TALPRLPTARAGVAVTALGKRIMVIGGV-------- 87

  Fly   370 IHPFGFCYCPLR---------NTWMTIAPIQQDRCRFSLNAVGTQHLYAVGGI-LDDDNEEALRM 424
                |....||:         ..|...:.:::.....|:.| ....:||.||: ||      ||.
Human    88 ----GTNQLPLKVVEMYNIDEGKWKKRSMLREAAMGISVTA-KDYRVYAAGGMGLD------LRP 141

  Fly   425 ISNVERYDIAKNVWTYMPSLQENRSQHAGVVVGDKLYISGGVHLANILASMWVFDTKTEVWQELA 489
            .::::.||:.|::|..:..:...|......:.|.|:|:.||......:.:..|||.:|..|.:..
Human   142 HNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVLGGRQSKYAVNAFEVFDIETRSWTKFP 206

  Fly   490 SMPTPCCDHVLVAVDNRIYACGGWHES-LTEWRVLVEHIYAYDIETNTW-----SVETKIPAPKF 548
            ::|........|.:||.:|:.||..:. |......:..:..:|:|...|     |...|.....|
Human   207 NIPYKRAFSSFVTLDNHLYSLGGLRQGRLYRQPKFLRTMDVFDMEQGGWLKMERSFFLKKRRADF 271

  Fly   549 YTGVTAMGRTIFFVGGLDSTESIDRASAETMAYDLDTKEWWHE-KDSWD------SPNDVWESTC 606
            ..| :..||.| ..|||.:..::           |:|.|.:|. |:.|:      :|    ...|
Human   272 VAG-SLSGRVI-VAGGLGNQPTV-----------LETAEAFHPGKNKWEILPAMPTP----RCAC 319

  Fly   607 VAIYVPNC 614
            .:|.|.||
Human   320 SSIVVKNC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB 38..142 CDD:279045
PHA03098 46..588 CDD:222983 71/298 (24%)
BACK 151..249 CDD:285009
KELCH repeat 344..390 CDD:276965 10/56 (18%)
KELCH repeat 394..444 CDD:276965 14/50 (28%)
Kelch 406..458 CDD:128874 13/52 (25%)
Kelch_1 448..492 CDD:279660 11/43 (26%)
KELCH repeat 448..492 CDD:276965 11/43 (26%)
Kelch_1 494..539 CDD:279660 10/50 (20%)
KELCH repeat 495..539 CDD:276965 10/49 (20%)
KLHDC8ANP_001258792.1 Kelch 1 1..31
BTB <5..209 CDD:333434 48/196 (24%)
KELCH repeat 21..65 CDD:276965 13/33 (39%)
Kelch 2 32..79 17/47 (36%)
KELCH repeat 69..162 CDD:276965 24/111 (22%)
Kelch 3 81..127 8/58 (14%)
Kelch 4 128..175 13/52 (25%)
BTB <129..333 CDD:333434 56/222 (25%)
KELCH repeat 165..210 CDD:276965 11/44 (25%)
Kelch 5 176..222 11/45 (24%)
Kelch 6 224..278 11/54 (20%)
KELCH repeat 268..314 CDD:276965 14/58 (24%)
Kelch 7 279..326 15/62 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.