| Sequence 1: | NP_608397.1 | Gene: | CG1812 / 33049 | FlyBaseID: | FBgn0031119 | Length: | 616 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006713078.1 | Gene: | KLHDC8B / 200942 | HGNCID: | 28557 | Length: | 371 | Species: | Homo sapiens |
| Alignment Length: | 255 | Identity: | 60/255 - (23%) |
|---|---|---|---|
| Similarity: | 102/255 - (40%) | Gaps: | 50/255 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 339 PHIDQCN-FGT-AVLNNKLFIVGGAYDVFLKEYIHPFGFCYCPL---------RNTWMTIAPIQQ 392
Fly 393 DRCRFSLNAVGTQHLYAVGGILDDDNEEALRMISNVERYDIAKNVWTYMPSLQENRSQHAGVVVG 457
Fly 458 D----------KLYISGGVHLANI-LASMWVFDTKTEVWQELASMPTPCCDHVLVAVDNRIYACG 511
Fly 512 ------GWHESLTEWRVLVEHIYAYDIETNTWSVETKIPAPKFYTGVTAMGRTIFFVGGL 565 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1812 | NP_608397.1 | BTB | 38..142 | CDD:279045 | |
| PHA03098 | 46..588 | CDD:222983 | 60/255 (24%) | ||
| BACK | 151..249 | CDD:285009 | |||
| KELCH repeat | 344..390 | CDD:276965 | 13/56 (23%) | ||
| KELCH repeat | 394..444 | CDD:276965 | 11/49 (22%) | ||
| Kelch | 406..458 | CDD:128874 | 11/51 (22%) | ||
| Kelch_1 | 448..492 | CDD:279660 | 11/54 (20%) | ||
| KELCH repeat | 448..492 | CDD:276965 | 11/54 (20%) | ||
| Kelch_1 | 494..539 | CDD:279660 | 13/50 (26%) | ||
| KELCH repeat | 495..539 | CDD:276965 | 12/49 (24%) | ||
| KLHDC8B | XP_006713078.1 | PRK14131 | 1..321 | CDD:237617 | 60/255 (24%) |
| Kelch_6 | 20..69 | CDD:290672 | 14/60 (23%) | ||
| KELCH repeat | 21..65 | CDD:276965 | 12/55 (22%) | ||
| Kelch_1 | 68..114 | CDD:279660 | 11/51 (22%) | ||
| KELCH repeat | 69..114 | CDD:276965 | 11/50 (22%) | ||
| KELCH repeat | 117..173 | CDD:276965 | 12/55 (22%) | ||
| Kelch | 139..184 | CDD:128874 | 13/44 (30%) | ||
| KELCH repeat | 175..227 | CDD:276965 | 12/55 (22%) | ||
| Kelch | 186..239 | CDD:128874 | 12/56 (21%) | ||
| Kelch_1 | 228..279 | CDD:279660 | 5/20 (25%) | ||
| KELCH repeat | 229..279 | CDD:276965 | 5/19 (26%) | ||
| Kelch_6 | 288..336 | CDD:290672 | |||
| KELCH repeat | 288..334 | CDD:276965 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||