DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and bath-23

DIOPT Version :9

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_494522.1 Gene:bath-23 / 190086 WormBaseID:WBGene00021727 Length:243 Species:Caenorhabditis elegans


Alignment Length:153 Identity:40/153 - (26%)
Similarity:66/153 - (43%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EKLTDVTLIVEEHRFKAHRVVLAASSDYFCAMFADCAMIESRKDEINLYGIKARAMGSIIDYIYT 109
            |:.:||.|.||:.:|...:..||:.|.||.::|.. :..|:.|.||.|..|.:.....:::.:|.
 Worm   115 EEFSDVILAVEDEKFYVLKKFLASHSSYFKSLFFG-SFAEAEKSEITLSEINSAGFQCLLEVLYG 178

  Fly   110 SMLELNYDNIEEILAAATHVQVREVIDRCTIFLGAKIEMENCLAIAGMADIYGIMDLSERAYRYM 174
            .. .::.:|::.||..|...::..||.:|          |.||           :|.|:|..|.:
 Worm   179 ES-AIDDENVDGILHLAHMNEMAFVIRKC----------EECL-----------LDKSDRPSRCI 221

  Fly   175 CAHFEEFATTSDFKEMKVDQLRF 197
                        ||..|..||.|
 Worm   222 ------------FKIAKQYQLEF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB 38..142 CDD:279045 27/96 (28%)
PHA03098 46..588 CDD:222983 39/152 (26%)
BACK 151..249 CDD:285009 12/47 (26%)
KELCH repeat 344..390 CDD:276965
KELCH repeat 394..444 CDD:276965
Kelch 406..458 CDD:128874
Kelch_1 448..492 CDD:279660
KELCH repeat 448..492 CDD:276965
Kelch_1 494..539 CDD:279660
KELCH repeat 495..539 CDD:276965
bath-23NP_494522.1 MATH <42..96 CDD:351761
BTB 115..208 CDD:366225 27/104 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133095at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.