DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and btb-5

DIOPT Version :10

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001317757.1 Gene:btb-5 / 189221 WormBaseID:WBGene00021042 Length:307 Species:Caenorhabditis elegans


Alignment Length:122 Identity:28/122 - (22%)
Similarity:54/122 - (44%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TDVTLIVEEHRFKAHRVVLAASSDYFCAMFADCAMIESRKDEINLYGIKARAMGSIIDYIYTSML 112
            ||..|:|:..:....:..|:..|.||..:|:. ...|::..||.:..:.......::..||.:|:
 Worm   148 TDAVLVVDGKKIYVCKAFLSFHSSYFRKLFSS-NFKEAQLTEIPIRDVSYEDFCLLLSTIYPNMI 211

  Fly   113 ELNYDNIEEILAAATHVQVREVIDRCTIFLGAKIEMENCLAIAGMADIYGIMDLSER 169
            ..|.:..:::|..|....:..|.:.....|....::| |..:..:||.|.|..|.|:
 Worm   212 FPNDETADKLLELADRFLMPAVTNMVGFHLCHSDKLE-CEQLIFLADKYSIPRLLEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB_POZ 33..151 CDD:453885 21/102 (21%)
PHA03098 46..588 CDD:222983 28/122 (23%)
KELCH repeat 344..390 CDD:276965
KELCH repeat 394..444 CDD:276965
KELCH repeat 448..492 CDD:276965
KELCH repeat 495..539 CDD:276965
btb-5NP_001317757.1 BTB 138..244 CDD:395526 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.