DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1812 and KLHDC7A

DIOPT Version :9

Sequence 1:NP_608397.1 Gene:CG1812 / 33049 FlyBaseID:FBgn0031119 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_689588.2 Gene:KLHDC7A / 127707 HGNCID:26791 Length:777 Species:Homo sapiens


Alignment Length:425 Identity:82/425 - (19%)
Similarity:138/425 - (32%) Gaps:182/425 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 KIEMENCLAIAGMADIYGIMDLSERAYRYMCAHFEEFATTSDFKEMKVDQLRFILSSNYPIDVAE 209
            ::::.||..:..:|....:..|.|.||:.|..::.:...:.|        :...||.      ||
Human   429 RLDLGNCYEVLTLAKRQNLEALKEAAYKVMSENYLQVLRSPD--------IYGCLSG------AE 479

  Fly   210 QDLVRLVCSFAIEQQLNESALGDLLRLIKWQHISYKSVDELRNMNCSLDKGKQLPLPTSYYNRIK 274
            ::|:       ::::|                                 :|:|            
Human   480 RELI-------LQRRL---------------------------------RGRQ------------ 492

  Fly   275 QEHMGHLLNGVVSLKDQSLPQGPTNMRGMELCLLKIGGFEWNGLTNVIMCFSPKKMNWYELTAIP 339
                 :|:...|..|:.|                  ||         :.|:..::..|..|..:|
Human   493 -----YLVVADVCPKEDS------------------GG---------LCCYDDEQDVWRPLARMP 525

  Fly   340 HIDQCNFGTAV--LNNKLFIVGGAYDVFLKEYIHPFG---------FCYCPLRNTWMTIAPIQQD 393
            . :..:.|.|:  |.|.||:|.|..           |         |||.||...|..:.|:.|.
Human   526 P-EAVSRGCAICSLFNYLFVVSGCQ-----------GPGHQPSSRVFCYNPLTGIWSEVCPLNQA 578

  Fly   394 R--CRF-SLNAVGTQHLYAVGGILDDDNEEALRMISNVERYDIAKNVWTYMPSLQEN--RSQHAG 453
            |  ||. :|:.    ||||:||          ..:::|||||...:.|.:.|.|..:  ...|..
Human   579 RPHCRLVALDG----HLYAIGG----------ECLNSVERYDPRLDRWDFAPPLPSDTFALAHTA 629

  Fly   454 VVVGDKLYISGG----------------------------VHLANILASMWVFD----------- 479
            .|...:::::||                            ..:..:...::.||           
Human   630 TVRAKEIFVTGGSLRFLLFRFSAQEQRWWAGPTGGSKDRTAEMVAVNGFLYRFDLNRSLGIAVYR 694

  Fly   480 --TKTEVWQELASMPTPCCDHVLVA-VDNRIYACG 511
              ..|.:|.|.|:..||..|....| |||.||..|
Human   695 CSASTRLWYECATYRTPYPDAFQCAVVDNLIYCVG 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1812NP_608397.1 BTB 38..142 CDD:279045
PHA03098 46..588 CDD:222983 82/425 (19%)
BACK 151..249 CDD:285009 14/97 (14%)
KELCH repeat 344..390 CDD:276965 15/56 (27%)
KELCH repeat 394..444 CDD:276965 17/52 (33%)
Kelch 406..458 CDD:128874 16/53 (30%)
Kelch_1 448..492 CDD:279660 10/84 (12%)
KELCH repeat 448..492 CDD:276965 10/84 (12%)
Kelch_1 494..539 CDD:279660 9/19 (47%)
KELCH repeat 495..539 CDD:276965 8/18 (44%)
KLHDC7ANP_689588.2 BACK_like 430..>470 CDD:297737 8/39 (21%)
KELCH repeat 531..575 CDD:276965 15/54 (28%)
Kelch 542..589 CDD:128874 17/57 (30%)
Kelch_1 578..619 CDD:279660 17/54 (31%)
KELCH repeat 579..619 CDD:276965 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.