| Sequence 1: | NP_608397.1 | Gene: | CG1812 / 33049 | FlyBaseID: | FBgn0031119 | Length: | 616 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031757044.1 | Gene: | klhdc8b / 100488297 | XenbaseID: | XB-GENE-950279 | Length: | 359 | Species: | Xenopus tropicalis |
| Alignment Length: | 232 | Identity: | 53/232 - (22%) |
|---|---|---|---|
| Similarity: | 82/232 - (35%) | Gaps: | 62/232 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 384 WMTIAPIQQDRCR-FSLNAVGTQHLYAVGGILDDDNEEALRMISNVERYDIAKNVWTYMPSLQEN 447
Fly 448 RSQHAGVVVGDKLYISGG----------VHLANILASMW-------------------------- 476
Fly 477 -------------VFDTKTEVWQELASMPTPCCDHVLVAVDNRIYACGGWHESLTEWRVLVEHIY 528
Fly 529 AYDIETNTWSVETKIPAPKFYTGVTAMGRTIFFVGGL 565 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1812 | NP_608397.1 | BTB | 38..142 | CDD:279045 | |
| PHA03098 | 46..588 | CDD:222983 | 53/232 (23%) | ||
| BACK | 151..249 | CDD:285009 | |||
| KELCH repeat | 344..390 | CDD:276965 | 1/5 (20%) | ||
| KELCH repeat | 394..444 | CDD:276965 | 15/50 (30%) | ||
| Kelch | 406..458 | CDD:128874 | 16/51 (31%) | ||
| Kelch_1 | 448..492 | CDD:279660 | 14/92 (15%) | ||
| KELCH repeat | 448..492 | CDD:276965 | 14/92 (15%) | ||
| Kelch_1 | 494..539 | CDD:279660 | 11/44 (25%) | ||
| KELCH repeat | 495..539 | CDD:276965 | 10/43 (23%) | ||
| klhdc8b | XP_031757044.1 | PHA03098 | <16..208 | CDD:222983 | 45/203 (22%) |
| KELCH repeat | 26..70 | CDD:276965 | 14/48 (29%) | ||
| KELCH repeat | 122..167 | CDD:276965 | 4/44 (9%) | ||
| KELCH repeat | 170..215 | CDD:276965 | 11/49 (22%) | ||
| PHA03098 | <203..>342 | CDD:222983 | 9/33 (27%) | ||
| KELCH repeat | 217..264 | CDD:276965 | 5/19 (26%) | ||
| KELCH repeat | 276..322 | CDD:276965 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||