DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP19D and Arhgap15

DIOPT Version :9

Sequence 1:NP_001285496.1 Gene:RhoGAP19D / 33048 FlyBaseID:FBgn0031118 Length:2206 Species:Drosophila melanogaster
Sequence 2:NP_722542.2 Gene:Arhgap15 / 76117 MGIID:1923367 Length:481 Species:Mus musculus


Alignment Length:272 Identity:96/272 - (35%)
Similarity:143/272 - (52%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1167 RKSS----SHKHIPDKDLGSPKSKNWKDLLFRRGGSGSGGVSHHDLAS---------PSACAAKQ 1218
            |.||    ||.||..|:   .|.::.|..:||...|.|.....:.:.|         ||....::
Mouse   215 RSSSSELPSHCHIDRKE---QKPEHRKSFMFRLHHSASDTSDKNRVKSRLKKFISRRPSLKTLQE 276

  Fly  1219 IGSI-----GVPLRS-CPMSKVNAYVPHLVEVCTNIVETKGLGVVGIYRIPGNKAAISELSELVN 1277
            .|.|     |..|.: |  .:.::.||..|:.|...||.:||.|.||||:.||.|.|.:|..:||
Mouse   277 KGLIKDQIFGSHLHTVC--EREHSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVN 339

  Fly  1278 TKDFQFESCASDD-RWEDVNVVSSLLKLFIRSLPDALMPASYYINFIEADKK-FGLERIVLLREI 1340
                |.|....|| :|||::||:..||:|.|.|.:.|.|.|::..|:||.|| ...|:|..:|.:
Mouse   340 ----QEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFVEAIKKQDSNEKIETMRSL 400

  Fly  1341 VESLPRHPYETMKHLIRHLCRVSGNCDVNRMEPKNLAIIFGPSIIRTPNDTLETAVKDMKHQCRI 1405
            |:.||...::|||.|.|||.::......|.|..::|.|:|||:::|..|::...|| .|.:|.:|
Mouse   401 VKRLPPPNHDTMKILFRHLTKIVAKASQNLMSTQSLGIVFGPTLLRAENESGNVAV-HMVYQNQI 464

  Fly  1406 VELLVTQYDYFF 1417
            .|.::|:||..|
Mouse   465 AEFMLTEYDKIF 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP19DNP_001285496.1 PDZ_signaling <151..205 CDD:238492
RhoGAP_ARHGAP21 1221..1417 CDD:239860 77/203 (38%)
Arhgap15NP_722542.2 PH 88..196 CDD:278594
PH_ARHGAP9-like 89..198 CDD:270053
RhoGAP_ARHGAP27_15_12_9 285..471 CDD:239868 73/192 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.