DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP19D and ARHGAP15

DIOPT Version :9

Sequence 1:NP_001285496.1 Gene:RhoGAP19D / 33048 FlyBaseID:FBgn0031118 Length:2206 Species:Drosophila melanogaster
Sequence 2:NP_060930.3 Gene:ARHGAP15 / 55843 HGNCID:21030 Length:475 Species:Homo sapiens


Alignment Length:466 Identity:127/466 - (27%)
Similarity:204/466 - (43%) Gaps:75/466 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1027 TSSGSSSANEPAANAAS---ALTASTSSSTCSSGPYTEILFKTKSSNEMKRLFGLLQWKDSLNYD 1088
            |..|:.:......||.|   .|:.|.|......|..||.:.:.:.::....|..::...:.|..:
Human    17 TRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHRRNHSQHILKDVIPPLEQLMVE 81

  Fly  1089 DNEHQPQ------GKQLAEPQKT---VASASYLDDVQGGASAADSSPLSSHSGGIADASGSH--- 1141
            ...:..:      ||:|.:...|   |.|:..::..:.....|.|:..:.|.....|..|:|   
Human    82 KEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLCGAHIEW 146

  Fly  1142 --------HVSALPAAA-----------------------AIVAATSDSISP-----VMKARKSS 1170
                    :|..:...:                       ||.....||..|     :.|.::||
Human   147 AKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSS 211

  Fly  1171 SHKHIP--DKDLGSPKSKNWKDLLFRRGGSGSGGVSHHDLAS---------PSACAAKQIGSIGV 1224
            |.:.:.  |.|:...|.::.|.|:||...|.|.....:.:.|         ||....::.|.|..
Human   212 STELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKD 276

  Fly  1225 PLRSCPMSKV----NAYVPHLVEVCTNIVETKGLGVVGIYRIPGNKAAISELSELVNTKDFQFES 1285
            .:....:.||    |:.||..|:.|...||.:||.|.||||:.||.|.|.:|..:||    |.|.
Human   277 QIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVN----QEEK 337

  Fly  1286 CASDD-RWEDVNVVSSLLKLFIRSLPDALMPASYYINFIEADKK-FGLERIVLLREIVESLPRHP 1348
            ...|| :|||::||:..||:|.|.||:.|.|.|::..|:||.|| ....||..::.:|:.||...
Human   338 LNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPN 402

  Fly  1349 YETMKHLIRHLCRVSGNCDVNRMEPKNLAIIFGPSIIRTPNDTLETAVKDMKHQCRIVELLVTQY 1413
            .:|||.|..||.::......|.|..::|.|:|||:::|..|:|...|: .|.:|.:|.||::::|
Human   403 RDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAI-HMVYQNQIAELMLSEY 466

  Fly  1414 DYFFEGGSLPD 1424
            ...|  ||..|
Human   467 SKIF--GSEED 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP19DNP_001285496.1 PDZ_signaling <151..205 CDD:238492
RhoGAP_ARHGAP21 1221..1417 CDD:239860 75/201 (37%)
ARHGAP15NP_060930.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 2/5 (40%)
PH 80..188 CDD:278594 13/107 (12%)
PH_ARHGAP9-like 81..190 CDD:270053 15/108 (14%)
RhoGAP_ARHGAP27_15_12_9 279..465 CDD:239868 73/190 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.