DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and RABGAP1L

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001353375.1 Gene:RABGAP1L / 9910 HGNCID:24663 Length:1051 Species:Homo sapiens


Alignment Length:286 Identity:58/286 - (20%)
Similarity:105/286 - (36%) Gaps:73/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVSFLASLLGL-SNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRYYYD-----LMSQ----- 54
            :::.|..:|..| ::.||.||..|:..||         ..|:..|.||..:     ||.|     
Human   725 LNIIFHVALALLKTSKEDLLQADFEGALK---------FFRVQLPKRYRAEENARRLMEQACNIK 780

  Fly    55 -PSRALFIIFRLSNMPFEDCVVALRNGEHLTED----FKKEINRFQ----RVPCIHDN-GYKLAE 109
             |::.|        ..:|.....:|..:...||    :|:|..|.|    |:...:|: .::|..
Human   781 VPTKKL--------KKYEKEYQTMRESQLQQEDPMDRYKRENRRLQEASMRLEQENDDLAHELVT 837

  Fly   110 SVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEA 174
            |...||.                 |..:.::..:..:..|.||..   |.|..|.....:....|
Human   838 SKIALRN-----------------DLDQAEDKADVLNKELLLTKQ---RLVETEEEKRKQEEETA 882

  Fly   175 KI-ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWL 238
            :: |.||.|:|:....:::           ::..:|:....|....||:.......| .::.. :
Human   883 QLKEVFRKQLEKAEYEIKK-----------TTAIIAEYKQICSQLSTRLEKQQAASK-EELEV-V 934

  Fly   239 KRVRQSCNPYYDV-AHEFVYKISGTG 263
            |....:|....|: :.|...|::.||
Human   935 KGKMMACKHCSDIFSKEGALKLAATG 960

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/95 (22%)
GstA 47..243 CDD:223698 39/216 (18%)
GST_C_Theta 135..259 CDD:198292 21/125 (17%)
RABGAP1LNP_001353375.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
PTB_Rab6GAP 129..257 CDD:269922
DUF3694 290..421 CDD:315198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 461..503
RabGAP-TBC 541..744 CDD:306939 5/18 (28%)
DUF3084 800..>1018 CDD:331293 37/194 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.