DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Usp6nl

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_852064.2 Gene:Usp6nl / 98910 MGIID:2138893 Length:842 Species:Mus musculus


Alignment Length:111 Identity:24/111 - (21%)
Similarity:42/111 - (37%) Gaps:29/111 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AILRYLSAKGKIPEHLYPKYFVD------------QSRVDEFLE--WQHMSLRLTCAMYFRTVWL 162
            |:::..|.    |:|....:||.            :..:::||.  .||:..:.....::...|.
Mouse   231 ALVKLFSG----PKHAMHGFFVQGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSFYTMKWF 291

  Fly   163 EPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTV 208
            ......|||       ||:    ||.:.:....||:..||..|.|:
Mouse   292 FQCFLDRTP-------FRL----NLRIWDIYIFEGERVLTAMSYTI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 2/8 (25%)
GstA 47..243 CDD:223698 24/111 (22%)
GST_C_Theta 135..259 CDD:198292 18/76 (24%)
Usp6nlNP_852064.2 TBC 120..335 CDD:214540 24/111 (22%)
SPRR2 <590..642 CDD:291486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.