DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTO1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:167 Identity:38/167 - (22%)
Similarity:65/167 - (38%) Gaps:32/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FKKEINRFQRVPCIHDN-GYKLAESVAILRYLS----AKGKIPEHLYPKYFVDQSRVDEFLEWQH 146
            |||  |.|..||.:.:: |..:.||.....||.    .|..:|:..|.|            ..|.
Human    64 FKK--NPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEK------------ACQK 114

  Fly   147 MSLRLTCAMYFRTVWLEPLLTG---RTPSEAKIETFRMQMERNLDVVEEVWLEGK-DFLTGSSLT 207
            |.|.|     |..|   |.|.|   |:.::......:.:..:....:|||....| .|..|:|::
Human   115 MILEL-----FSKV---PSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSIS 171

  Fly   208 VADIFAACEIEQTRMADYDVRIKY-PKIRAWLKRVRQ 243
            :.|.......|:......:..:.: ||::.|:..:::
Human   172 MIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKE 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 12/38 (32%)
GstA 47..243 CDD:223698 38/165 (23%)
GST_C_Theta 135..259 CDD:198292 22/114 (19%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 11/31 (35%)