DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Clic5

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:251 Identity:45/251 - (17%)
Similarity:76/251 - (30%) Gaps:101/251 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALRN----------GEH-----LTEDFKKEINRFQRVPCIHDNGY 105
            |:.||:|..|..:.|....|.|:.          |.|     ...|.|.::|:.:..        
  Rat    35 SQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEF-------- 91

  Fly   106 KLAESVAILRYLSAKGKIPEHLYPKYFV-----DQSRVDEFLEWQHMSLRLTCAMYFRTVWLE-- 163
             |.|::.           ||. |||...     :.:.:|.|.::         :.|.:....:  
  Rat    92 -LEETLT-----------PEK-YPKLAARHRESNTAGIDIFSKF---------SAYIKNTKQQNN 134

  Fly   164 -PLLTGRTPSEAKIETFRMQMERNLDVVEEVWL--------EGKDFLTGSSLTVAD--------- 210
             .|..|.|.:..|::.:     .|..:.||:..        ..:.||.|..||:||         
  Rat   135 AALERGLTKALRKLDDY-----LNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHV 194

  Fly   211 --------------------------IFAACEIEQTRMADYDVRIKYPKIRAWLKR 240
                                      .:|..|...|..||.::.:.|..:...|.|
  Rat   195 VKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVARRLSR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 15/79 (19%)
GstA 47..243 CDD:223698 45/251 (18%)
GST_C_Theta 135..259 CDD:198292 25/152 (16%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 15/82 (18%)
O-ClC 14..249 CDD:129941 43/248 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.